Property Summary

NCBI Gene PubMed Count 25
PubMed Score 20.58
PubTator Score 14.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.6e-02
non primary Sjogren syndrome sicca 1.300 2.9e-02
ovarian cancer 1.100 1.7e-03

Synonym

Accession Q8TAE8 Q8IVM3 Q8TE51 Q969P9 Q9BSM6
Symbols PRG6
CRIF1
PLINP
CKBBP2
Plinp1
MRP-L59
PLINP-1
CKbetaBP2

PDB

3J9M   3J7Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

PMID Text
26210498 Study shows that Lck interacts with CRIF1 in the mitochondria and negatively regulates CRIF1-mediated translation of mitochondrion-encoded proteins.
25997448 our results support a novel function of nuclear Lck in promoting human leukemic T cell survival through interaction with a tumor suppressor, CRIF1
25847389 Crif1 is an indispensable regulator of PKAalpha cat that modulates the PKA/CREB signaling pathway to promote adipogenic differentiation of bone marrow mesenchymal stem cells after irradiation
25361083 The results identify the ROS-Sp1-Crif1 pathway to be a new mechanism underlying Abeta-induced mitochondrial dysfunction and suggest that ROS-mediated downregulation of Crif1 is a crucial event in AD pathology.
24906005 CRIF1 knockdown partially induces endothelial activation via increased ROS production and phosphorylation of p66shc
24520316 CRIF1 may play a regulatory role in the BM microenvironment-induced leukemia cell cycle arrest possibly through interacting with CDK2 and acting as a cyclin-dependent kinase inhibitor.
24103312 CKbetaBP2/CRIF1 is expressed with STAT3 in prostate cancer where STAT3 may help to offset the AR repressor effect of CKbetaBP2/CRIF1.
21911160 results indicated cell cycle arrest of Jurkat cells in the G0/G1 phase to be induced by primary cultured leukemic BMSCs associated with increased expression of CRIF1 by leukemic cells
20427290 CRIF1, unlike KEAP1 (which only interacts with N-terminal region of NRF2), physically interacts with both N- and C-terminal regions of NRF2 and promotes NRF2 ubiquitination and subsequent proteasome-mediated NRF2 protein degradation
17885209 Results suggest that CRIF1 acts as an AR corepressor and may play an important role in the regulation of AR-positive growth of prostate cancer.
17804717 NAC-1 contributes to tumor growth and survival by at least inhibiting Gadd45GIP1 expression, which has a tumor suppressor effect in cancer cells.
17069992 Phosphorylation of serine-221 in CKBBP2/CRIF1 promotes proliferation of green monkey COS7 cells.
12716909 results suggest that CRIF1 is a novel nuclear protein that interacts with Gadd45 and may play a role in negative regulation of cell cycle progression and cell growth

AA Sequence

MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGV      1 - 70
VPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQR     71 - 140
ENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAV    141 - 210
AQDPAASGAPSS                                                              211 - 222
//

Text Mined References (31)

PMID Year Title
26210498 2015 Lymphocyte-specific protein tyrosine kinase (Lck) interacts with CR6-interacting factor 1 (CRIF1) in mitochondria to repress oxidative phosphorylation.
25997448 2015 Nuclear lymphocyte-specific protein tyrosine kinase and its interaction with CR6-interacting factor 1 promote the survival of human leukemic T cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847389 2015 Crif1 Promotes Adipogenic Differentiation of Bone Marrow Mesenchymal Stem Cells After Irradiation by Modulating the PKA/CREB Signaling Pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25361083 2015 CR6-interacting factor 1 is a key regulator in A?-induced mitochondrial disruption and pathogenesis of Alzheimer's disease.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24906005 2014 CRIF1 deficiency induces p66shc-mediated oxidative stress and endothelial activation.
24520316 2014 CRIF1 interacting with CDK2 regulates bone marrow microenvironment-induced G0/G1 arrest of leukemia cells.
24103312 2014 Mechanism of androgen receptor corepression by CK?BP2/CRIF1, a multifunctional transcription factor coregulator expressed in prostate cancer.
23908630 2013 Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome.
22453275 2012 Mitochondrial nucleoid interacting proteins support mitochondrial protein synthesis.
21911160 2011 Cell cycle arrest of Jurkat cells by leukemic bone marrow stromal cells: possible mechanisms and involvement of CRIF1.
21269460 2011 Initial characterization of the human central proteome.
20427290 2010 CR6-interacting factor 1 (CRIF1) regulates NF-E2-related factor 2 (NRF2) protein stability by proteasome-mediated degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19305429 2009 NAC-1, a potential stem cell pluripotency factor, contributes to paclitaxel resistance in ovarian cancer through inactivating Gadd45 pathway.
18200042 2008 Crif1 is a novel transcriptional coactivator of STAT3.
17885209 2008 CR6-interacting factor 1 represses the transactivation of androgen receptor by direct interaction.
17804717 2007 NAC-1 controls cell growth and survival by repressing transcription of Gadd45GIP1, a candidate tumor suppressor.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17069992 2007 Phosphorylation of CKBBP2/CRIF1 by protein kinase CKII promotes cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459248 2005 CR6-interacting factor 1 interacts with orphan nuclear receptor Nur77 and inhibits its transactivation.
15231747 2004 A protein interaction framework for human mRNA degradation.
12716909 2003 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle.
12482659 2002 Interaction of human papillomavirus type 16 L2 with cellular proteins: identification of novel nuclear body-associated proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11710515 2001 Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins.
10441517 1999 Isolation of differentially expressed cDNAs from p53-dependent apoptotic cells: activation of the human homologue of the Drosophila peroxidasin gene.