Property Summary

NCBI Gene PubMed Count 53
PubMed Score 286.80
PubTator Score 39.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG      1 - 70
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL     71 - 140
FCEESRSVNDWVPSITLPE                                                       141 - 159
//

Text Mined References (54)

PMID Year Title