Property Summary

NCBI Gene PubMed Count 48
PubMed Score 280.71
PubTator Score 39.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.16 1.6

Expression

Synonym

Accession O95257 Q5VZ87 Q9C076
Symbols CR6
DDIT2
GRP17
GADD45gamma

Gene

PDB

2WAL   3FFM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (28)

PMID Text
26521045 GADD45G protein, human
26378039 Results establish that the dowregulation of GADD45G-SIP1 axis may contribute to cellular senescence evasion and HCC development.
26172295 we demonstrated that GADD45gamma expression in hepatocellular carcinoma cells was associated with sorafenib sensitivity
25415264 demonstrate for the first time that miR-383 can specifically regulates the expression of Gadd45g by directly targeting to the 3-UTR region of Gadd45g mRNA, a regulatory process conserved in human tumor cells and mouse embryonic stem cells
25126861 Expression of GADD45gamma was significantly higher in pituitary adenomas of female patients.
24577085 Suggest that cucurbitacin E induced mitosis delay is regulated by GADD45gamma overexpression in malignant gliomas.
24104471 The gadd45g gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review)
23897841 GADD45G functions as a negative regulator of the Jak-Stat3 pathway and inhibits hepatocellular carcinoma by inducing cellular senescence.
23793925 Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression in esophageal squamous cell carcinoma.
23616123 Methylation-mediated repression of GADD45G expression is associated with gastric cardia adenocarcinoma.
23512105 In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample.
22752116 Knock-down of GADD45gamma significantly attenuates TNF-a and IL-6 production in the human monocyte-macrophage THP-1 cell line as well as in human peripheral blood mononuclear cells
22058036 These results reveal the mechanism of self-association by Gadd45 proteins and the importance of this self-association for their biological function
21931671 Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation.
21850407 clinically non-functioning adenomas had a significant decrease (P<0.001) in the relative levels of GADD45c expression (13 of 14 adenomas or 92%), compared to functioning adenomas (11 of 24 or 46%)
20739400 The induction of GADD45gamma gene expression by 1,25-(OH)2D3 may mark therapeutic response in prostate cancer.
20111973 Epigenetic regulation of GADD45G is associated with carcinogenesis in stomach, colorectal and pancreateic cancers.
19293565 urinary GADD45gamma expression is associated with progression of renal disease
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19048389 Flow cytometric analysis revealed significant G2/M arrest in cells transfected with either Gadd45alpha or Gadd45gamma. Importantly, we found that expression of either Gadd45alpha or Gadd45gamma activated P38 and JNK kinase pathways to induce G2/M arrest.
18997345 Human Gadd45gamma and its selenomethionine derivative were expressed in an Escherichia coli expression system and purified; they were then crystallized using the hanging-drop vapour-diffusion method.
17178890 Establish MDA-7/IL-24 and GADD45alpha and GADD45gamma as critical mediators of apoptosis and growth arrest in response to NSAIDs in cancer cells.
16166418 Results show that GADD45G can act as a functional new-age tumor suppressor but being frequently inactivated epigenetically in multiple tumors.
15353598 Inhibition of GADD45alpha and gamma in cancer cells by small interfering RNA abrogates apoptosis induction by the inhibitor of NF-kappaB
15062559 GADD45g induction by androgens requires new protein synthesis; overexpression of GADD45g inhibited cell growth and caused morphological changes in prostate cell lines, arguing that GADD45g is involved in differentiation induced by androgens
14672412 Data show that GADD45 gamma mRNA expression is down-regulated in hepatocellular carcinoma, and that GADD45 gamma causes cell cycle arrest at G2/M transition when transfected into Hep-G2 cells.
12716909 results suggest that CRIF1 is a novel nuclear protein that interacts with Gadd45 and may play a role in negative regulation of cell cycle progression and cell growth
11889197 a powerful growth suppressor controlling pituitary cell proliferation and the first identified gene whose expression is lost in the majority of human pituitary tumors.

AA Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG      1 - 70
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL     71 - 140
FCEESRSVNDWVPSITLPE                                                       141 - 159
//

Text Mined References (49)

PMID Year Title
26521045 2016 Nuclear spheres modulate the expression of BEST1 and GADD45G.
26378039 2015 SIP1 is a downstream effector of GADD45G in senescence induction and growth inhibition of liver tumor cells.
26172295 2015 Growth arrest DNA damage-inducible gene 45 gamma expression as a prognostic and predictive biomarker in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25415264 2014 MicroRNA-383 regulates the apoptosis of tumor cells through targeting Gadd45g.
25126861 2014 Expression analysis of GADD45?, MEG3, and p8 in pituitary adenomas.
24577085 2014 Inducement of mitosis delay by cucurbitacin E, a novel tetracyclic triterpene from climbing stem of Cucumis melo L., through GADD45? in human brain malignant glioma (GBM) 8401 cells.
24104471 2013 Gadd45 in modulation of solid tumors and leukemia.
23897841 2014 Growth arrest and DNA damage 45G down-regulation contributes to Janus kinase/signal transducer and activator of transcription 3 activation and cellular senescence evasion in hepatocellular carcinoma.
23793925 2013 Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression and poor prognosis in esophageal squamous cell carcinoma.
23616123 2013 Methylation-mediated repression of GADD45A and GADD45G expression in gastric cardia adenocarcinoma.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
22752116 2012 GADD45? regulates TNF-? and IL-6 synthesis in THP-1 cells.
22058036 2011 Crystal structure of human Gadd45? [corrected] reveals an active dimer.
21931671 2011 Combinatorial effect of non-steroidal anti-inflammatory drugs and NF-?B inhibitors in ovarian cancer therapy.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21850407 2012 Expression of cell growth negative regulators MEG3 and GADD45? is lost in most sporadic human pituitary adenomas.
20739400 2010 GADD45gamma: a new vitamin D-regulated gene that is antiproliferative in prostate cancer cells.
20111973 2010 Semi-quantitative detection of GADD45-gamma methylation levels in gastric, colorectal and pancreatic cancers using methylation-sensitive high-resolution melting analysis.
19293565 2009 Urinary GADD45gamma expression is associated with progression of lgA nephropathy.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19048389 2009 Gadd45-alpha and Gadd45-gamma utilize p38 and JNK signaling pathways to induce cell cycle G2/M arrest in Hep-G2 hepatoma cells.
18997345 2008 Purification, crystallization and preliminary X-ray diffraction analysis of human Gadd45gamma.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17178890 2006 A novel pathway involving melanoma differentiation associated gene-7/interleukin-24 mediates nonsteroidal anti-inflammatory drug-induced apoptosis and growth arrest of cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16166418 2005 The stress-responsive gene GADD45G is a functional tumor suppressor, with its response to environmental stresses frequently disrupted epigenetically in multiple tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15353598 2004 NF-kappa B-mediated repression of growth arrest- and DNA-damage-inducible proteins 45alpha and gamma is essential for cancer cell survival.
15062559 2004 Gadd45gamma is androgen-responsive and growth-inhibitory in prostate cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672412 2003 GADD45gamma, down-regulated in 65% hepatocellular carcinoma (HCC) from 23 chinese patients, inhibits cell growth and induces cell cycle G2/M arrest for hepatoma Hep-G2 cell lines.
12716909 2003 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124778 2002 GADD45b and GADD45g are cdc2/cyclinB1 kinase inhibitors with a role in S and G2/M cell cycle checkpoints induced by genotoxic stress.
11498536 2001 Oligomerization of human Gadd45a protein.
11078829 2000 UV-induced expression of GADD45 is mediated by an oxidant sensitive pathway in cultured human keratinocytes and in human skin in vivo.
11022036 2001 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control.
10973963 2000 Identification of a functional domain in a GADD45-mediated G2/M checkpoint.
10872826 2000 Gadd45 family proteins are coactivators of nuclear hormone receptors.
10773677 2000 Assignment of human GADD45G to chromosome 9q22.1-->q22.3 by radiation hybrid mapping.
10597261 1999 Cytokine response gene 6 induces p21 and regulates both cell growth and arrest.
10496071 1999 Molecular cloning, expression, and mapping of a novel human cDNA, GRP17, highly homologous to human gadd45 and murine MyD118.
10490824 1999 CR6: A third member in the MyD118 and Gadd45 gene family which functions in negative growth control.
10455148 1999 A novel oncostatin M-inducible gene OIG37 forms a gene family with MyD118 and GADD45 and negatively regulates cell growth.
9827804 1998 A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK.
7681987 1993 Isolation of interleukin 2-induced immediate-early genes.