Property Summary

NCBI Gene PubMed Count 49
PubMed Score 178.13
PubTator Score 75.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Rheumatoid Arthritis 1.400 1.1e-02
gastric cancer -1.100 7.5e-04
hepatocellular carcinoma -1.200 6.0e-06
Multiple myeloma 1.665 1.7e-02
urothelial carcinoma -1.700 1.1e-03
psoriasis -2.000 2.0e-08
group 4 medulloblastoma -3.100 2.1e-06
astrocytoma 1.500 6.0e-03
glioblastoma 1.900 6.7e-03
medulloblastoma, large-cell -3.200 3.9e-06
primitive neuroectodermal tumor -1.900 2.1e-04
primary pancreatic ductal adenocarcinoma 1.688 6.0e-03
non-small cell lung cancer -2.584 1.4e-24
intraductal papillary-mucinous adenoma (... -2.700 1.9e-04
intraductal papillary-mucinous carcinoma... -1.800 2.1e-02
intraductal papillary-mucinous neoplasm ... -1.900 1.2e-02
lung cancer -3.700 6.2e-07
colon cancer -1.900 3.4e-02
posterior fossa group B ependymoma -1.200 1.9e-02
aldosterone-producing adenoma -1.689 8.1e-03
lung adenocarcinoma -1.793 1.5e-06
lung carcinoma -1.500 1.8e-08
spina bifida -1.741 3.6e-02
acute myeloid leukemia 2.500 2.2e-02
ovarian cancer 3.600 1.6e-07
pituitary cancer -3.600 9.9e-12
chronic rhinosinusitis -1.307 3.1e-02
pancreatic cancer 1.500 4.5e-03

Synonym

Accession O75293 A8KAM2 O75960 Q17R46
Symbols MYD118
GADD45BETA

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (28)

PMID Text
24104474 Gadd45B protects the liver through two entirely different processes: binding MKK7 to block damaging signal transduction or binding CAR to coactivate anabolic transcription. (Review)
24104471 The gadd45b gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review)
23110778 as such may play an unappreciated role in tumorigenesis. The exact mechanism of GADD45B inactivation and overexpression requires further investigation. GADD45B could be a potential therapeutic target for CRC treatment in future
22096849 Cadmium chloride can induce DNA damage and increase expression levels of the gadd153 and gadd45beta promoters in HepG2 cells.
22048458 finding show there is an increased expression and decreased promoter binding of GADD45b in psychotic subjects.
21810943 GADD45beta is a novel pituitary tumor suppressor whose reexpression blocks proliferation, survival, and tumorigenesis
21127053 PXR activates the GADD45beta gene, increasing p38 MAPK phosphorylation, and leading HepG2 cells to change morphology and migrate.
21062976 Findings suggest that GADD45beta induction contributes to sorafenib-induced apoptosis in HCC cells, prompting further studies to validate its potential value in predicting sorafenib efficacy.
20942912 The association of GADD45beta expression and pathological grading of chondrosarcoma in the present study suggests that the immunohistochemical study of GADD45beta may be a specific diagnostic parameter for chondrosarcoma cell differentiation.
20558744 Findings suggest that Gadd45b mediates p38-induced Rb phosphorylation by enhancing the interaction between p38 and Rb during Fas-induced apoptosis in murine hepatocytes.
20530689 Diminished Gadd45beta expression leads to aberrant cell cycle arrest and diminished DNA excision repair and is associated with HCV-associated hepatocellular carcinomas.
19877043 Deficient Gadd45beta expression in RA can contribute to activation of JNK, exacerbate clinical arthritis, and augment joint destruction.
19834918 The stress-mediated induction of gadd45b by distinct stressors is differentially regulated at the level of mRNA transcription or mRNA stability, which is largely distinct from gadd45a.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18576389 These observations suggest that GADD45beta might play an important role in regulating chondrocyte homeostasis by modulating collagen gene expression and promoting cell survival in normal adult cartilage and in early OA
18515079 Haplotype (rs2024144-rs3783501) of GADD45B affected the thickness of inter-ventricular septum in patients with hypertrophy cardiomyopathy.
18343408 The results suggest the occurrence of a large complex containing at least an MKK7-Gadd45 beta:Gadd45 beta-MKK7 tetrameric unit whose complexity could be further increased by the dimeric nature of the isolated MKK7.
17591973 our results suggest that GADD45beta induction by SAMe via NF-kappaB may represent a novel mechanism of SAMe-mediated hepatoprotection, with p53 playing an important role.
17485467 Association of Gadd45beta with MKK7 involves a network of interactions mediated by its putative helices alpha3 and alpha4 and loops 1 and 2
17437852 We found significant differences in gene expression, specifically with a group of genes, including GADD45beta, known to be responsive to estrogen or to interact with estrogen receptor.
16144844 GADD45beta plays an essential role during chondrocyte terminal differentiation and mediates MMP-13 gene expression
15642734 NF-kappaB, ERK, and GADD45beta are able to coordinate in a loop-like signaling network to defend cells against the cytotoxicity induced by ionizing radiation
15546867 TGF-beta induces biglycan expression through ALK5 and GADD45beta
15509538 methylation might play a crucial role in the epigenetic regulation of GADD45beta in hepatocyte transformation that may be directed by p53 status
14630914 SMAD3 and SMAD4 activate gadd45beta through its third intron to facilitate G2 progression following TGFbeta treatment
12855571 in B cells, Gadd45 beta is induced by CD40 through a mechanism that requires NF-kappa B and that induction suppresses Fas-mediated killing
12759252 Results suggest that GADD45beta, which is down-regulated in most cases of hepatocellular carcinoma (HCC), remains an ideal candidate for development as a molecular marker in the diagnosis of HCC and as a potential therapeutic target.
12162804 participation of NF-kappaB in the regulation of Gadd45beta

AA Sequence

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA      1 - 70
LQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVAS     71 - 140
YCEESRGNNQWVPYISLQER                                                      141 - 160
//

Text Mined References (50)

PMID Year Title
25314077 2014 Cancer-selective targeting of the NF-?B survival pathway with GADD45?/MKK7 inhibitors.
24104474 2013 Gadd45 in the liver: signal transduction and transcriptional mechanisms.
24104471 2013 Gadd45 in modulation of solid tumors and leukemia.
23110778 2012 Abnormal expression of GADD45B in human colorectal carcinoma.
22096849 2011 [The effects of the cadmium chloride on the DNA damage and the expression level of gadd gene in HepG2 cell line].
22048458 2012 Growth arrest and DNA-damage-inducible, beta (GADD45b)-mediated DNA demethylation in major psychosis.
21810943 2011 Identification of growth arrest and DNA-damage-inducible gene beta (GADD45beta) as a novel tumor suppressor in pituitary gonadotrope tumors.
21127053 2011 Pregnane X receptor PXR activates the GADD45beta gene, eliciting the p38 MAPK signal and cell migration.
21062976 2010 Induction of DNA damage-inducible gene GADD45beta contributes to sorafenib-induced apoptosis in hepatocellular carcinoma cells.
20942912 2010 Gadd45? expression in chondrosarcoma: a pilot study for diagnostic and biological implications in histological grading.
20558744 2010 Gadd45b mediates Fas-induced apoptosis by enhancing the interaction between p38 and retinoblastoma tumor suppressor.
20530689 2010 Downregulation of Gadd45beta expression by hepatitis C virus leads to defective cell cycle arrest.
19877043 2009 Gadd45beta deficiency in rheumatoid arthritis: enhanced synovitis through JNK signaling.
19834918 2009 Distinct mechanisms are utilized to induce stress sensor gadd45b by different stress stimuli.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18576389 2008 Differential expression of GADD45beta in normal and osteoarthritic cartilage: potential role in homeostasis of articular chondrocytes.
18515079 2008 GADD45B inhibits MKK7-induced cardiac hypertrophy and the polymorphisms of GADD45B is associated with inter-ventricular septum hypertrophy.
18343408 2008 Gadd45 beta forms a homodimeric complex that binds tightly to MKK7.
17591973 2007 The induction of growth arrest DNA damage-inducible gene 45 beta in human hepatoma cell lines by S-adenosylmethionine.
17485467 2007 Insights into the structural basis of the GADD45beta-mediated inactivation of the JNK kinase, MKK7/JNKK2.
17437852 2007 Up-regulation of estrogen responsive genes in hypospadias: microarray analysis.
16256071 2005 CIN85 regulates the ability of MEKK4 to activate the p38 MAP kinase pathway.
16144844 2005 A novel role for GADD45beta as a mediator of MMP-13 gene expression during chondrocyte terminal differentiation.
15642734 2005 Co-activation of ERK, NF-kappaB, and GADD45beta in response to ionizing radiation.
15546867 2005 Transforming growth factor-beta (TGF-beta) type I receptor/ALK5-dependent activation of the GADD45beta gene mediates the induction of biglycan expression by TGF-beta.
15509538 2004 Hypermethylation of growth arrest DNA damage-inducible gene 45 beta promoter in human hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630914 2004 Identification of a gadd45beta 3' enhancer that mediates SMAD3- and SMAD4-dependent transcriptional induction by transforming growth factor beta.
12855571 2003 Gadd45 beta mediates the protective effects of CD40 costimulation against Fas-induced apoptosis.
12759252 2003 Down-regulation of growth arrest DNA damage-inducible gene 45beta expression is associated with human hepatocellular carcinoma.
12716909 2003 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12162804 2002 Regulation of the gadd45beta promoter by NF-kappaB.
12124778 2002 GADD45b and GADD45g are cdc2/cyclinB1 kinase inhibitors with a role in S and G2/M cell cycle checkpoints induced by genotoxic stress.
12052864 2002 Regulation of MTK1/MEKK4 kinase activity by its N-terminal autoinhibitory domain and GADD45 binding.
11498536 2001 Oligomerization of human Gadd45a protein.
11078829 2000 UV-induced expression of GADD45 is mediated by an oxidant sensitive pathway in cultured human keratinocytes and in human skin in vivo.
10973963 2000 Identification of a functional domain in a GADD45-mediated G2/M checkpoint.
10872826 2000 Gadd45 family proteins are coactivators of nuclear hormone receptors.
10828065 2000 Characterization of MyD118, Gadd45, and proliferating cell nuclear antigen (PCNA) interacting domains. PCNA impedes MyD118 AND Gadd45-mediated negative growth control.
10773677 2000 Assignment of human GADD45G to chromosome 9q22.1-->q22.3 by radiation hybrid mapping.
10101024 1999 Post-transcriptional regulation of MyD118 and GADD45 in human lung carcinoma cells during 6-[3-(1-adamantyl)-4-hydroxyphenyl]-2- naphthalene carboxylic acid-induced apoptosis.
9827804 1998 A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK.
9151207 1997 Cell cycle and apoptosis: possible roles of Gadd45 and MyD118 proteins inferred from their homology to ribosomal proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8700517 1996 The differentiation primary response gene MyD118, related to GADD45, encodes for a nuclear protein which interacts with PCNA and p21WAF1/CIP1.
1899477 1991 Sequence and expression of a cDNA encoding MyD118: a novel myeloid differentiation primary response gene induced by multiple cytokines.