Property Summary

NCBI Gene PubMed Count 55
PubMed Score 199.97
PubTator Score 75.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia 2.500 2.2e-02
aldosterone-producing adenoma -1.411 3.1e-02
astrocytoma 1.500 6.0e-03
chronic rhinosinusitis -1.307 3.1e-02
colon cancer -1.900 3.4e-02
gastric cancer -1.100 7.5e-04
glioblastoma 1.900 6.7e-03
group 3 medulloblastoma -2.500 2.8e-04
hepatocellular carcinoma -1.200 6.0e-06
intraductal papillary-mucinous adenoma (... -2.700 1.9e-04
intraductal papillary-mucinous carcinoma... -1.800 2.1e-02
intraductal papillary-mucinous neoplasm ... -1.900 1.2e-02
lung adenocarcinoma -1.200 6.2e-04
lung cancer -2.700 4.1e-06
lung carcinoma -1.500 1.8e-08
medulloblastoma, large-cell -3.200 3.9e-06
Multiple myeloma 1.665 1.7e-02
non-small cell lung cancer -2.584 1.4e-24
ovarian cancer 3.600 1.6e-07
pancreatic cancer 1.500 4.5e-03
pancreatic ductal adenocarcinoma liver m... -1.330 1.9e-02
pituitary cancer -3.600 9.9e-12
posterior fossa group B ependymoma -1.200 1.9e-02
primitive neuroectodermal tumor -1.900 2.1e-04
psoriasis 1.400 1.6e-04
Rheumatoid arthritis 1.200 4.0e-02
spina bifida -1.741 3.6e-02
urothelial carcinoma -1.700 1.1e-03

Synonym

Accession O75293 A8KAM2 O75960 Q17R46
Symbols MYD118
GADD45BETA

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Component (2)

Gene RIF (34)

AA Sequence

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA      1 - 70
LQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVAS     71 - 140
YCEESRGNNQWVPYISLQER                                                      141 - 160
//

Text Mined References (56)

PMID Year Title