Property Summary

NCBI Gene PubMed Count 149
PubMed Score 373.29
PubTator Score 344.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 2.955 2.7e-08
adrenocortical carcinoma 1.100 1.5e-02
adult high grade glioma 1.100 4.1e-03
Amyotrophic lateral sclerosis 2.233 3.5e-08
Astrocytoma, Pilocytic 1.500 1.5e-06
autosomal dominant Emery-Dreifuss muscul... 2.158 4.3e-04
dermatomyositis 1.300 2.9e-03
Duchenne muscular dystrophy 1.933 2.5e-10
glioblastoma 1.100 3.7e-04
group 3 medulloblastoma 1.100 1.8e-02
juvenile dermatomyositis 2.084 2.1e-12
limb girdle muscular dystrophy 2A 1.112 3.3e-04
lung cancer 1.400 2.0e-04
malignant mesothelioma -1.200 2.0e-06
osteosarcoma -1.924 7.5e-03
pancreatic cancer 1.400 1.1e-03
primary pancreatic ductal adenocarcinoma 1.466 5.1e-03
tuberculosis -1.300 2.4e-04

Protein-protein Interaction (9)

Gene RIF (121)

AA Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA      1 - 70
LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL     71 - 140
SQLICFCRESRYMDQWVPVINLPER                                                 141 - 165
//

Text Mined References (152)

PMID Year Title