Property Summary

Ligand Count 13
NCBI Gene PubMed Count 39
PubMed Score 51.44
PubTator Score 30.26

Knowledge Summary

Patent (521)

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 4.300 8.2e-54
medulloblastoma, large-cell 1.200 8.2e-04

Gene RIF (26)

AA Sequence

MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKS      1 - 70
PLTKSEQLLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPSTNN     71 - 140
LSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAMCNMDFSRFPLDTQ    141 - 210
TCSLEIESYAYTEDDLMLYWKKGNDSLKTDERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRH    211 - 280
IFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWV    281 - 350
SFVFVFLSVLEYAAVNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKP    351 - 420
DRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS               421 - 479
//

Text Mined References (41)

PMID Year Title