Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.05
PubTator Score 18.68

Knowledge Summary

Patent (481)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.800 1.5e-03
astrocytoma -1.500 9.2e-08
Astrocytoma, Pilocytic -2.300 5.1e-07
atypical teratoid / rhabdoid tumor -1.700 1.6e-04
glioblastoma -2.000 9.3e-07
group 3 medulloblastoma -2.200 4.7e-03
medulloblastoma, large-cell -1.700 4.6e-05
oligodendroglioma -1.100 9.3e-07
ovarian cancer -2.300 4.8e-13
posterior fossa group B ependymoma 3.300 4.8e-09
primitive neuroectodermal tumor -4.000 5.0e-04

Gene RIF (19)

AA Sequence

MGPLKAFLFSPFLLRSQSRGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQILNS      1 - 70
LLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFNSTMKVLMLNSNMV     71 - 140
GKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMDEHSCPLEFSSYG    141 - 210
YPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIMTIFFDLSRRMGYFTIQTYIP    211 - 280
CILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALME    281 - 350
YGTLHYFTSNQKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFE    351 - 420
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL                             421 - 465
//

Text Mined References (24)

PMID Year Title