Property Summary

Ligand Count 16
NCBI Gene PubMed Count 50
PubMed Score 21.74
PubTator Score 21.29

Knowledge Summary

Patent (1,424)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.400 4.1e-04
astrocytoma -1.300 8.7e-08
Astrocytoma, Pilocytic -2.900 1.3e-04
atypical teratoid / rhabdoid tumor -4.900 1.2e-06
ependymoma -4.000 5.9e-10
glioblastoma -3.600 7.0e-07
group 3 medulloblastoma -2.200 2.0e-03
lung carcinoma 2.300 1.1e-16
medulloblastoma, large-cell -5.100 3.3e-06
oligodendroglioma -1.400 1.7e-05
ovarian cancer -1.300 5.2e-07
pituitary cancer -2.800 4.2e-04
primitive neuroectodermal tumor -3.100 8.1e-03
progressive supranuclear palsy 1.100 4.9e-03

Gene RIF (28)

AA Sequence

MWTVQNRESLGLLSFPVMITMVCCAHSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVA      1 - 70
SIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRM     71 - 140
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQ    141 - 210
FSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGI    211 - 280
TTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANE    281 - 350
KNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDR    351 - 420
HGVPSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH                    421 - 474
//

Text Mined References (53)

PMID Year Title