Property Summary

Ligand Count 26
NCBI Gene PubMed Count 41
PubMed Score 19.33
PubTator Score 31.69

Knowledge Summary

Patent (777)


  Differential Expression (2)

Disease log2 FC p
ependymoma -1.200 2.0e-02
subependymal giant cell astrocytoma -6.285 3.8e-04

Gene RIF (41)

AA Sequence

SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE                                         421 - 453

Text Mined References (42)

PMID Year Title