Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.91
PubTator Score 0.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.500 2.9e-02
intraductal papillary-mucinous adenoma (... 1.700 3.2e-03
intraductal papillary-mucinous carcinoma... 1.200 2.6e-02
osteosarcoma -1.970 1.4e-04
ovarian cancer -1.700 4.0e-09

Gene RIF (4)

AA Sequence

MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRAGVSRDARTKV      1 - 70
DRTPLHMAAADGHAHIVELLVRNGADVNAKDMLKMTALHWATERHHRDVVELLIKYGADVHAFSKFDKSA     71 - 140
FDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDP    141 - 210
HASTVQFSNSTTSVLATLAALAEASVPLSNSHRATANTEEIIEGNSVDSSIQQVMGSGGQRVITIVTDGV    211 - 280
PLGNIQTSIPTGGIGQPFIVTVQDGQQVLTVPAGKVAEETVIKEEEEEKLPLTKKPRIGEKTNSVEESKE    281 - 350
GNERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGE    351 - 420
LEERETKVTGSAGTTEPHTRVSMATVSS                                              421 - 448
//

Text Mined References (10)

PMID Year Title