Property Summary

NCBI Gene PubMed Count 34
PubMed Score 36.23
PubTator Score 37.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 3.300 6.0e-04
malignant mesothelioma 1.200 1.0e-06
cutaneous lupus erythematosus 1.100 7.1e-03
osteosarcoma -1.442 1.3e-05
medulloblastoma 1.600 1.8e-06
atypical teratoid / rhabdoid tumor -2.200 6.4e-05
glioblastoma -2.200 3.3e-04
medulloblastoma, large-cell -2.100 1.3e-02
primitive neuroectodermal tumor 1.500 1.9e-04
tuberculosis -1.100 1.5e-02
adult high grade glioma -1.800 9.3e-03
lung adenocarcinoma -1.500 8.0e-13
inflammatory breast cancer -1.300 6.3e-04
invasive ductal carcinoma 1.300 5.5e-04
ovarian cancer 1.500 1.1e-03

Protein-protein Interaction (6)

Gene RIF (13)

PMID Text
23856623 The NRF-2beta nuclear localization signal (NLS) is an unusual but is, nevertheless, a bona fide monopartite-type NLS.
23684612 GABP beta is required for YAP expression in vitro and in vivo, and that YAP is an important effector downstream of GABP for cell survival and cell-cycle progression.
21609478 NRF-1 and GABP expression is coordinated by NRF-1's activation of the GABPbeta promoter
21076620 Data show that BRAF knockdown led to suppression of the expression of the GABPbeta, which involved in regulating HPR1 promoter activity.
20028934 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of GA binding protein transcription factor, beta subunit 1 (GABPB1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18660489 Observational study of gene-disease association. (HuGE Navigator)
18343819 The results are consistent with a pathway whereby PRC regulates NRF-2-dependent genes through a multiprotein complex involving HCF-1.[NRF-2beta]
17726090 serum-responsive GABP binding to Ets-binding sites activates the KIS promoter, leading to KIS gene expression, cell migration, and cell cycle progression
17357964 Observational study of gene-disease association. (HuGE Navigator)
16412436 Results point out that brain-specific angiogenesis inhibitor 2 controls VEGF transcription through GA-binding protein under normal conditions and cerebral ischemia [GA-binding protein gamma].
12016589 Mutation of a nuclear respiratory factor 2 binding site in the 5' untranslated region of the ADSL gene in three patients with adenylosuccinate lyase deficiency.
9461436 The cyrstal structure of a ternary complex containing the mouse GA binding protein transcription factor, beta subunit 2, was resolved at 2.15 angstrom resolution.

AA Sequence

MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDARTKV      1 - 70
DRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTA     71 - 140
FDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSENSSKATDETG    141 - 210
VSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGI    211 - 280
QLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREAL    281 - 350
QKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV                             351 - 395
//

Text Mined References (39)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23856623 2013 Nuclear Respiratory Factor 2? (NRF-2?) recruits NRF-2? to the nucleus by binding to importin-?:? via an unusual monopartite-type nuclear localization signal.
23684612 2013 The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21609478 2011 Decreased expression of BRCA1 in SK-BR-3 cells is the result of aberrant activation of the GABP Beta promoter by an NRF-1-containing complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21076620 2010 Induction of heparanase-1 expression by mutant B-Raf kinase: role of GA binding protein in heparanase-1 promoter activation.
20028934 2010 Interaction between SNPs in the NRF2 gene and elite endurance performance.
19060904 2009 An empirical framework for binary interactome mapping.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18343819 2008 PGC-1-related coactivator complexes with HCF-1 and NRF-2beta in mediating NRF-2(GABP)-dependent respiratory gene expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18020712 2007 The ets-related transcription factor GABP directs bidirectional transcription.
17726090 2008 GA-binding protein regulates KIS gene expression, cell migration, and cell cycle progression.
17357964 2007 NRF2 genotype improves endurance capacity in response to training.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16412436 2006 Brain-specific angiogenesis inhibitor 2 regulates VEGF through GABP that acts as a transcriptional repressor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12016589 2002 Mutation of a nuclear respiratory factor 2 binding site in the 5' untranslated region of the ADSL gene in three patients with adenylosuccinate lyase deficiency.
11953439 2002 YEAF1/RYBP and YAF-2 are functionally distinct members of a cofactor family for the YY1 and E4TF1/hGABP transcription factors.
10675337 2000 The novel coactivator C1 (HCF) coordinates multiprotein enhancer formation and mediates transcription activation by GABP.
10585419 1999 Synergistic transcriptional activation by hGABP and select members of the activation transcription factor/cAMP response element-binding protein family.
9857059 1998 Transcriptional up-regulation of the delayed early gene HRS/SRp40 during liver regeneration. Interactions among YY1, GA-binding proteins, and mitogenic signals.
9792629 1998 Functional interactions of transcription factor human GA-binding protein subunits.
9461436 1998 The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA.
9242441 1997 Retinoblastoma binding factor 1 site in the core promoter region of the human RB gene is activated by hGABP/E4TF1.
9016666 1996 Functional domains of transcription factor hGABP beta1/E4TF1-53 required for nuclear localization and transcription activation.
8816484 1996 Nuclear respiratory factors 1 and 2 utilize similar glutamine-containing clusters of hydrophobic residues to activate transcription.
8441384 1993 cDNA cloning of transcription factor E4TF1 subunits with Ets and notch motifs.
8383622 1993 Identity of GABP with NRF-2, a multisubunit activator of cytochrome oxidase expression, reveals a cellular role for an ETS domain activator of viral promoters.
7958862 1994 Molecular and genetic characterization of GABP beta.
7918435 1994 Purification and characterization of nuclear factors binding to the negative regulatory element D of human apolipoprotein A-II promoter: a negative regulatory effect is reversed by GABP, an Ets-related protein.
7799916 1995 Four structurally distinct, non-DNA-binding subunits of human nuclear respiratory factor 2 share a conserved transcriptional activation domain.
7737900 1995 Regional mapping of two subunits of transcription factor E4TF1 to human chromosome.