1. Home
  2. Targets
  3. transcription factor
  4. GA-binding protein alpha chain

Tbio GA-binding protein alpha chain

Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.

This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2010]

 Comments

Property Summary

NCBI Gene PubMed Count 56
PubMed Score 28.75
PubTator Score 61.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count Z-score Confidence
Aseptic Meningitis 6 3.188 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.300 1.7e-06
glioblastoma 1.300 4.0e-06
group 4 medulloblastoma 1.600 5.0e-04
pediatric high grade glioma 1.200 1.3e-03
atypical teratoid/rhabdoid tumor 1.100 2.2e-04
pilocytic astrocytoma 1.100 4.2e-04
ovarian cancer -1.200 1.1e-03

Synonym

Accession Q06546 Q12939 GABP subunit alpha
Symbols NFT2
NRF2
NRF2A
E4TF1A
E4TF1-60
RCH04A07

Gene

GABPA

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (8)

 GO Function (9)

 GO Component (3)

 GO Process (7)

 Compartment GO Term (27)

See all...

 IMPC Phenotype (2)

 MGI Phenotype (9)

 HCA RNA Cell Line (56)

See all...

Pathway (10)

Protein-protein Interaction (8)

HCFC1   MAPK12   GABPB1   MAPK11   MAPK14   NRF1   PPRC1   PPARGC1A  

Gene RIF (34)

PMID Text
26553150 ELF1 binding occurs at both TERT promoter mutations in melanoma in vitro such that increased recruitment of GABP is enabled by the spatial architecture of native and novel ETS motifs in the TERT promoter region.
26185160 GABPalpha Binding to Overlapping ETS and CRE DNA Motifs Is Enhanced by CREB1
26170143 study supports the crucial role of GABP in myeloid cell differentiation and identified ITGAM/CD11b as a novel GABP target gene
26109058 The results suggest that NRF-2alpha is a regulator of SIRT3 expression and may shed light on how SIRT3 is upregulated during nutrient stress.
26072332 Expression of the ETS transcription factor GABPalpha is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
25977370 GABPA thus directly links TERT promoter mutations to aberrant expression in multiple cancers.
24481480 GABPA exhibits an increase in binding signal with higher numbers of ETS motifs per promoter. Analysis of the distance between inverted pairs of ETS motifs within promoters and binding by p53, ETS1 and GABPA, shows a coordination of binding for the 3.
24076158 results demonstrate the functional importance of the C/EBPalpha C-terminus beyond the bZIP DNA-binding and dimerization region, which may mediate cooperative activation by C/EBPalpha and GABP of myeloid-specific genes
23856623 When NRF-2alpha and NRF-2beta form a complex, the nuclear import of NRF-2alphabeta becomes strictly dependent on the nuclear localization signal within NRF-2beta.
23684612 GABP alpha is required for YAP expression in vitro and in vivo, and that YAP is an important effector downstream of GABP for cell survival and cell-cycle progression.
23284628 although ELK1 and GABPA ultimately control the same biological process, they do so by regulating different cohorts of target genes associated with cytoskeletal functions and cell migration contro
23099293 The phenotype is best uniformly termed congenital cone-rod synaptic disorder. In Saudi Arabia a founder homozygous c.81_82insA CABP4 mutation is a recurrent cause.
22749526 Results suggest that the NRF-2 A/C polymorphism is associated with endurance performance at the elite level in a Spanish population.
22480519 Epigallocatechin-3-gallate (EGCG)-mediated inhibition of HIV-1 Tat-induced LTR transactivation involves activation of Nrf2 and AMPK signaling pathways and inhibition of AKT signaling pathway in MAGI cells
21774808 an Nrf2-dependent response to exogenous stimuli may affect annual FEV1 decline
21624509 Hepatoprotection of quercetin against oxidative stress by induction of metallothionein expression through activating MAPK and PI3K pathways and enhancing Nrf2 DNA-binding activity.
20127517 expression of NRF-2alpha in hepatocellular carcinoma (HCC) and tumor-adjacent specimens; higher-grade frequency of expression of NRF-2alpha in tumor-adjacent tissues was higher than tumor tissues, suggesting NRF-2alpha may play important role in carcinogenesis of HCC
20028934 NRF2 A/C and NRF2 C/T single nucleotide polymorphisms (SNPs) are associated, separately and in combination, with elite endurance athletes.
19951946 Data show that NRF2 binds to the proximal promoter region of the genes coding for the mTERF, POLRMT, the B subunit of the DNA polymerase-gamma, TWINKLE, and the single-stranded DNA-binding protein mtSSB.
19687146 Data show that a significant overlaps between the ELK1- and SRF-binding regions, and between ELK1- and GABPA-binding regions.
19409485 Epigallocatechin-3-gallate (EGCG)-mediated inhibition of HIV-1 Tat-induced LTR transactivation involves activation of Nrf2 and AMPK signaling pathways and inhibition of AKT signaling pathway in MAGI cells
19324871 The intronic DNase I-hypersensitive sites element acts in cis to maintain transcriptional competency at the TMS1 locus and that this activity is mediated by the ets transcription factor, GABPalpha.
19187944 study identified a decrease in a transcription factor complex containing NRF-2 in nuclear extracts from multiple sclerosis cortex; decrease correlates with decreased expression of electron transport chain subunit genes & increased oxidative damage
19116932 ILF-3, which has been known to regulate IL-2 expression in T cells, up-regulates synoviolin expression with GABPalpha in rheumatoid synovial cells
18852034 nuclear respiratory factor-2 binding site methylation suppresses the promoter activity of the human TOMM70 gene
18660489 Observational study of gene-disease association. (HuGE Navigator)
18378679 Elf-1 in combination with Sp1 and GABP reduced FcRgamma promoter activity.
18020712 These findings demonstrate that GABP regulates the majority of divergent promoters and suggest that bidirectional transcriptional activity is mediated through GABP binding and transactivation at both divergent and nondivergent promoters.
17304221 Upon activation of AChR, GABP recruits the histone acetyl transferase (HAT) p300 on the AChR epsilon subunit promoter, whereas it rather recruits the histone deacetylase HDAC1 when the promoter is not activated.
17161026 NRF-2 may play a key role in the regulation of mitochondrial protein synthesis in a cell line.
16581781 GABPA and p300 are essential components of retinoic acid-induced enhanceosome in myeloid cells.
16574658 TRAP220/MED1 plays a novel coregulatory role in facilitating the recruitment of TRAP/Mediator to specific target genes involved in growth and cell cycle progression via GABP
15928042 there is a physical interaction between the GABPalpha subunit and C/EBPalpha
15361867 GABP is essential for the regulation of IL-7Ralpha expression in T cells.

AA Sequence 

MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICL      1 - 70
QDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEE     71 - 140
AQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDI    141 - 210
DLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSAT    211 - 280
PTTIKVINSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKL    281 - 350
NQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE    351 - 420
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN                                        421 - 454
//

Text Mined References (58)

PMID Year Title
26553150 2016 An interaction proteomics survey of transcription factor binding at recurrent TERT promoter mutations.
26185160 2015 GABP? Binding to Overlapping ETS and CRE DNA Motifs Is Enhanced by CREB1: Custom DNA Microarrays.
26170143 2015 The heteromeric transcription factor GABP activates the ITGAM/CD11b promoter and induces myeloid differentiation.
26109058 2015 Nuclear respiratory factor 2 induces SIRT3 expression.
26072332 2015 Expression of the ETS transcription factor GABP? is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
25977370 2015 Cancer. The transcription factor GABP selectively binds and activates the mutant TERT promoter in cancer.
24481480 2014 Preferred binding of gain-of-function mutant p53 to bidirectional promoters with coordinated binding of ETS1 and GABPA to multiple binding sites.
24076158 2013 Identification of the C/EBP? C-terminal tail residues involved in the protein interaction with GABP and their potency in myeloid differentiation of K562 cells.
23856623 2013 Nuclear Respiratory Factor 2? (NRF-2?) recruits NRF-2? to the nucleus by binding to importin-?:? via an unusual monopartite-type nuclear localization signal.
23684612 2013 The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense.
23284628 2012 The ETS transcription factors ELK1 and GABPA regulate different gene networks to control MCF10A breast epithelial cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23099293 2013 Clinical characterisation of the CABP4-related retinal phenotype.
22749526 2013 The rs12594956 polymorphism in the NRF-2 gene is associated with top-level Spanish athlete's performance status.
22306510 2012 Identification of Rhit as a novel transcriptional repressor of human Mpv17-like protein with a mitigating effect on mitochondrial dysfunction, and its transcriptional regulation by FOXD3 and GABP.
21774808 2011 An interaction between Nrf2 polymorphisms and smoking status affects annual decline in FEV1: a longitudinal retrospective cohort study.
21624509 2011 Hepatoprotection of quercetin against oxidative stress by induction of metallothionein expression through activating MAPK and PI3K pathways and enhancing Nrf2 DNA-binding activity.
21269460 2011 Initial characterization of the human central proteome.
20127517 2011 Abnormal expression of NRF-2? in hepatocellular carcinoma identified with a newly prepared monoclonal antibody against human NRF-2? protein.
20028934 2010 Interaction between SNPs in the NRF2 gene and elite endurance performance.
19951946 2010 Nuclear respiratory factor 2 induces the expression of many but not all human proteins acting in mitochondrial DNA transcription and replication.
19687146 2009 Elucidation of the ELK1 target gene network reveals a role in the coordinate regulation of core components of the gene regulation machinery.
19324871 2009 Methylation-sensitive regulation of TMS1/ASC by the Ets factor, GA-binding protein-alpha.
19187944 2009 Impaired regulation of electron transport chain subunit genes by nuclear respiratory factor 2 in multiple sclerosis.
19116932 2009 Activation of synoviolin promoter in rheumatoid synovial cells by a novel transcription complex of interleukin enhancer binding factor 3 and GA binding protein alpha.
18852034 2008 In vitro methylation of nuclear respiratory factor-2 binding sites suppresses the promoter activity of the human TOMM70 gene.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18378679 2008 Cooperative regulation of Fc receptor gamma-chain gene expression by multiple transcription factors, including Sp1, GABP, and Elf-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18020712 2007 The ets-related transcription factor GABP directs bidirectional transcription.
17357964 2007 NRF2 genotype improves endurance capacity in response to training.
17304221 2007 Postsynaptic chromatin is under neural control at the neuromuscular junction.
17161026 2007 Nuclear respiratory factor 2 activates transcription of human mitochondrial translation initiation factor 2 gene.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16581781 2006 GA-binding protein and p300 are essential components of a retinoic acid-induced enhanceosome in myeloid cells.
16574658 2006 Regulation of Aurora-A kinase gene expression via GABP recruitment of TRAP220/MED1.
15928042 2005 C/EBPalpha functionally and physically interacts with GABP to activate the human myeloid IgA Fc receptor (Fc alphaR, CD89) gene promoter.
15361867 2004 GA binding protein regulates interleukin 7 receptor alpha-chain gene expression in T cells.
12750007 2003 Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11237613 2001 Sp1 and Sp3 physically interact and co-operate with GABP for the activation of the utrophin promoter.
10830953 2000 The DNA sequence of human chromosome 21.
10675337 2000 The novel coactivator C1 (HCF) coordinates multiprotein enhancer formation and mediates transcription activation by GABP.
10660899 2000 Human nuclear respiratory factor 2 alpha subunit cDNA: isolation, subcloning, sequencing, and in situ hybridization of transcripts in normal and monocularly deprived macaque visual system.
10585419 1999 Synergistic transcriptional activation by hGABP and select members of the activation transcription factor/cAMP response element-binding protein family.
9990060 1999 GA-binding protein factors, in concert with the coactivator CREB binding protein/p300, control the induction of the interleukin 16 promoter in T lymphocytes.
9857059 1998 Transcriptional up-regulation of the delayed early gene HRS/SRp40 during liver regeneration. Interactions among YY1, GA-binding proteins, and mitogenic signals.
9792629 1998 Functional interactions of transcription factor human GA-binding protein subunits.
9461436 1998 The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA.
9016666 1996 Functional domains of transcription factor hGABP beta1/E4TF1-53 required for nuclear localization and transcription activation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8543189 1995 Assignment of the E4TF1-60 gene to human chromosome 21q21.2-q21.3.
8441384 1993 cDNA cloning of transcription factor E4TF1 subunits with Ets and notch motifs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7799916 1995 Four structurally distinct, non-DNA-binding subunits of human nuclear respiratory factor 2 share a conserved transcriptional activation domain.
7737900 1995 Regional mapping of two subunits of transcription factor E4TF1 to human chromosome.
7590737 1995 Mapping of the human transcription factor GABPA (E4TF1-60) gene to chromosome 21.