Property Summary

Ligand Count 10
NCBI Gene PubMed Count 119
PubMed Score 258.98
PubTator Score 344.88

Knowledge Summary

Patent (1,223)

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.400 7.7e-07
Astrocytoma, Pilocytic 1.200 1.8e-06
atypical teratoid / rhabdoid tumor -3.100 3.5e-07
ependymoma -2.700 1.7e-16
glioblastoma -1.900 2.4e-06
group 3 medulloblastoma -3.500 2.0e-05
intraductal papillary-mucinous carcinoma... -1.100 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 7.9e-03
lung cancer -1.800 2.2e-04
medulloblastoma, large-cell -3.700 9.5e-08
osteosarcoma -2.535 2.1e-05
Pick disease -1.500 6.2e-04
primitive neuroectodermal tumor -1.500 9.2e-04
psoriasis -2.700 8.4e-05
subependymal giant cell astrocytoma -3.477 1.4e-02
tuberculosis 2.000 2.5e-07
Waldenstrons macroglobulinemia -1.031 6.0e-03

PDB (10)

Gene RIF (86)

AA Sequence

MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGE      1 - 70
REVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGS     71 - 140
SRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYE    141 - 210
LKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF    211 - 280
PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVP    281 - 350
VKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVE    351 - 420
GHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGR    421 - 490
SGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDL    491 - 560
SWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLN    561 - 630
NLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKE    631 - 700
WRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWL    701 - 770
GIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLA    771 - 840
IVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVS    841 - 910
ELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK                       911 - 961
//

Text Mined References (119)

PMID Year Title