Property Summary

NCBI Gene PubMed Count 116
PubMed Score 246.07
PubTator Score 344.88

Knowledge Summary

Patent (1,223)

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.031 6.0e-03
psoriasis -2.700 8.4e-05
glioblastoma -2.300 2.4e-04
osteosarcoma -2.535 2.1e-05
posterior fossa group A ependymoma -2.800 2.8e-18
group 3 medulloblastoma -3.500 2.0e-05
atypical teratoid/rhabdoid tumor -3.200 2.1e-09
medulloblastoma, large-cell -3.700 9.5e-08
primitive neuroectodermal tumor -1.500 9.2e-04
tuberculosis 2.000 2.5e-07
intraductal papillary-mucinous carcinoma... -1.100 7.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 7.9e-03
lung cancer -2.100 2.5e-05
adult high grade glioma -2.400 7.7e-07
pilocytic astrocytoma 1.200 2.7e-06
subependymal giant cell astrocytoma -3.477 1.4e-02
Pick disease -1.500 6.2e-04

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
More...

Gene RIF (83)

PMID Text
26817839 Cell surface ubiquitination precedes endocytosis, after which USP14 acts as an ubiquitin-binding protein that targets the ubiquitinated GABA B receptor to lysosomal degradation and promotes its deubiquitination.
26727527 Results show that GABBR1 minor genotypes/alleles were protective against risk for alcoholism in 3 ethnically diverse cohorts.
25725285 GABA(B)R stimulation promotes chemotaxis in RBL cells which is dependent on signaling via PI3-K/Akt, Src kinases and on rearrangement of both microtubules and actin cytoskeleton.
25465316 the first report of abnormal levels of GABA+ and Glx in mood-related brain regions of women with PMDD, indicating that dysregulation of the amino acid neurotransmitter system may be an important neurobiological mechanism in the pathogenesis of PMDD.
24778228 The endoplasmic reticulum retention signal of GBR1 is not part of the core coiled-coil structure, suggesting that it is sterically shielded by GBR2 upon heterodimer formation.
24682435 GABBR1 receptors are expressed in aortic smooth muscle cells and regulate the [Ca(2+)]i via a Gi/o-coupled receptor pathway and a phospholipase C activation pathway.
24209778 Chronic alcohol altered exon/intron expression and splice junction levels.
24006265 GABBR1 protein involved in phenylthiourea bitter taste detection.
23391219 Authors suggest GABBR1, GABA receptor B1, is implicated in schizophrenia based on a Human endogenous retrovirus long terminal repeat (HERV-W LTR) in the regulatory region of GABBR1.
23192081 Activation of GABA(B) receptors significantly inhibits Akt/GSK-3 signaling in a beta-arrestin-dependent pathway.
23007731 GABA may inhibit the growth of cholangiocarcinoma QBC939 cells through the GABAB receptor, and the anti-cancer effects may be partly mediated via the JAK/STAT3 pathway
22722631 Long interval intracortical inhibition is significantly reduced and the cortical silent period is significantly shortened in patients with succinic semialdehyde dehydrogenase (SSADH) deficiency compared to heterozygous parents and control groups.
22660477 The GBR2 ectodomain directly interacts with the GBR1 ectodomain to increase agonist affinity by selectively stabilizing the agonist-bound conformation of GBR1.
22613715 Results show that GABA(B) receptors R1 and R2 must be activated for the modulation of N-type (Ca(v)2.2) calcium channels by analgesic alpha-conotoxins Vc1.1 and RgIA.
22321358 This study does not support that GBR1 is involved in essential tremor.
21932037 We have discovered main triplets of amino acid residues in the GABAB1 receptor and several other neural receptors which seem to come from immunoglobulin chains and appear also as homologies in receptor heteromers.
21621395 The present meta-analysis suggests that GABBR1 G1465A polymorphism is associated with the risk of temporal lobe epilepsy.
21303731 The results of this study provided evidence of Gabbr1 Deficit in schizophrenia and mood disorders.
21124972 Data suggest that the GABAB1 intron 4 containing N-terminal truncation is necessary for the inhibitory action of the new splice variants.
20655490 The overexpression of one particular gene encoding for G-protein-activated inward rectifying potassium type 2 (GIRK2) channel subunit and its coupling to GABA(B) receptors may contribute to a range of mental and functional disabilities in Down syndrome.
20655483 This chapter reviews data suggesting that neurogliaform cells produce electrophysiological effects onto other neurons in the cortical cell network via GABA(B)R-mediated volume transmission that is highly regulated by GAT1 activity.
20655482 Current knowledge on a new role of GABA(B)R as an ambience-dependent regulator of synaptic signaling, is presented.
20655481 The relationships between the GABA(B) receptor, its effectors and associated proteins that mediate GABA(B) receptor function within the brain, is described.
20655480 The role that this phosphorylation plays in determining GABA(B)R effector coupling and their trafficking within the endocytic pathway, is discussed.
20655479 This chapter focuses on the recently emerged mechanisms of GABA(B) receptor exocytosis, endocytosis, recycling, and degradation.
20655478 This chapter summarizes current understanding of the molecular function of the GABA(B) receptor and recent developments in the identification of allosteric modulators.
20557420 Significant reductions in GABA(B) receptor subunit 1 density are demonstrated in cingulate cortex and fusiform gyrus from patients with autism compared to controls.
20538960 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
20036641 GABAB1 subunits interact with DGCR6 in the endoplasmic reticulum prior to their recruitment into functional GABAB receptors.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19763258 variants of GABBR1 and GABBR2 are associated with nicotine dependence in European- and African-American populations
19763258 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19664746 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19327013 Data show that GABA is a potent chemoattractant of HUCB stem/progenitor cells specifically through GABA(B)R activation.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19052921 GABA-B(1A) receptors are able to activate the ERK1/2 pathway despite the absence of surface targetting partner GABA-B(2)
19002745 Levels of GABBR1 are significantly decreased in brains of patients with autism compared with normal brains.
18653317 No evidence of significant allelic, genotypic, or haplotypic associations were identified in the tag SNPs of the GABBR1 gene in patients with MTLE, and the polymorphism at G1465A was not observed in samples of this study.
18403780 GABA may modulate an uncharacterized signaling cascade via GABA(B) receptors coupled to G(i) protein in airway epithelium
18355961 no significant association between the GABBR1 c.1456G>A polymorphism and sporadic or familial temporal lobe epilepsy
18255321 The genotype distribution varied significantly between patients and controls. Heterozygous carriers of the A-allele had a 10-fold increase in risk for MTLE-HS (OR 10.01; 95% CI 3.98-25.18, p=3.788E-08).
18255321 Observational study of gene-disease association. (HuGE Navigator)
18098271 Data suggest the stimulation of GABA B R signaling as a novel target for the treatment and prevention of pancreatic cancer.
17971048 Observational study of gene-disease association. (HuGE Navigator)
17591780 CaRs and GABA-B-R subunits can form heteromeric complexes in cells, and their interactions affect cell surface expression and signaling of CaR, which may contribute to extracellular Ca(2+)-dependent receptor activation in target tissues
17412563 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17264536 Observational study of gene-disease association. (HuGE Navigator)
17264536 the Ala20Val polymorphism of the GABA(B)R1 gene may be associated with obstructive sleep apnea syndrome(OSAS);Gly489Ser polymorphism does not seem to be involved in OSAS; C/C variant of the Phe658Phe polymorphism GABA(B)R1 gene seems associated with OSAS
16829628 Functional GABA(B) receptors are expressed in human airway smooth muscle cells
16499773 Observational study of gene-disease association. (HuGE Navigator)
16176975 COPI and 14-3-3 specifically bind to the GB1 RSR sequence and that COPI is involved in its intracellular retention
15946333 Observational study of gene-disease association. (HuGE Navigator)
15863499 positive allosteric modulators bind a single subunit of (B) receptor (metabotropic glutamate receptor) dimers
15857448 Observational study of gene-disease association. (HuGE Navigator)
15820424 Observational study of gene-disease association. (HuGE Navigator)
15799783 Observational study of gene-disease association. (HuGE Navigator)
15799783 Temporal lobe epilepsy preceded by febrile seizures is not associated with the polymorphisms or mutations in the GABBR1 gene.
15759131 The changes in hippocampal GBR1 may reflect alterations in the balance between excitatory and inhibitory neurotransmitter systems, which likely contributes to dysfunction of hippocampal circuitry in Alzheimer disease.
15685626 The observed trends suggest that further investigations of the role of the GABBR1 gene in obsessive-compulsive disorder are warranted.
15482257 identification of the minimal functional domain which still binds a competitive radioligand and leads to a functional, GABA-responding receptor when co-expressed with GABA(B2)
15474078 The simultaneous blockade of GABAA and GABAB receptors suppressed acrosome reaction induced by follicular fluid(FF). GABA receptors may play role in sperm activation. This may shed further light on mechanism of FF action on human sperm acrosome reaction.
15309313 Observational study of gene-disease association. (HuGE Navigator)
15304491 Data show that the two CCP modules of the GABA(B) 1a receptor have strikingly different structural properties, reflecting their different functions.
14978362 The GABA(B) receptor may be present as a heterodimer with subunits of GABA(B1) and GABA(B2) in the human colon.
14966130 Association of the GABA(B)R1 with the GABA(A) receptor gamma2S subunit robustly promotes cell surface expression of GABA(B)R1 in the absence of GABA(B)R2, that is usually required for efficient trafficking of GABA(B)R1 to the cell surface.
14961561 GABA(B) receptor subunit GABA(B)R1 is found on the same neurons and follows the same distribution patterns in the basal ganglia as the GABABR2 receptor subunit.
14707142 GABAB receptor cell surface stability is modulated by phosphorylation and chronic agonist treatment
14643764 Altered GABA(B1a) receptor mRNA expression occurs in human temporal lobe epilepsy; possibly the observed changes may also serve to counteract ongoing hyperexcitability.
14625043 Increased expression of GABA(B) receptor subtype 1 indicates augmented presynaptic inhibition of glutamate release as a possible protective mechanism in temporal lobe epilepsy.
12923192 GHB, administered in vivo, reduces MAP kinase phosphorylation via a direct activation of GABAB receptors by GHB, but was found ineffective on MAP kinase phosphorylation in brain slices
12770685 Observational study of gene-disease association. (HuGE Navigator)
12770685 GABBR1 gene might not be a susceptibility gene for childhood absence epilepsy at least in the Chinese population
12645817 Post hoc analyses showed an association between EEG phenotype and exon 7 genotype in normal subjects only.
12601092 The GABA(B[1]) polymorphism (G1465A) confers a highly increased susceptibility to temporal lobe epilepsy. Moreover, it seems to influence the severity of this common epileptic disorder
12555235 evidence that the translated polymorphism of exon 7 may be functionally meaningful and impact cortical EEG oscillations
12130687 The intracellular loops of the GB2 subunit are crucial for G-protein coupling of the heteromeric gamma-aminobutyrate B receptor.
12115687 Alterations in inhibitory synaptic transmission through GABA(B)R1 appears to affect differentially certain hippocampal circuits in a population of epileptic patients and could contribute to the pathophysiology of temporal lobe epilepsy.
11844143 Observational study of gene-disease association. (HuGE Navigator)
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGE      1 - 70
REVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGS     71 - 140
SRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYE    141 - 210
LKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF    211 - 280
PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVP    281 - 350
VKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVE    351 - 420
GHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGR    421 - 490
SGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDL    491 - 560
SWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLN    561 - 630
NLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKE    631 - 700
WRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWL    701 - 770
GIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLA    771 - 840
IVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVS    841 - 910
ELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK                       911 - 961
//

Text Mined References (116)

PMID Year Title
26817839 2016 Post-endocytotic Deubiquitination and Degradation of the Metabotropic ?-Aminobutyric Acid Receptor by the Ubiquitin-specific Protease 14.
26727527 2016 GABBR1 and SLC6A1, Two Genes Involved in Modulation of GABA Synaptic Transmission, Influence Risk for Alcoholism: Results from Three Ethnically Diverse Populations.
25725285 2015 Cytoskeletal rearrangement and Src and PI-3K-dependent Akt activation control GABA(B)R-mediated chemotaxis.
25465316 2015 Alterations of GABA and glutamate-glutamine levels in premenstrual dysphoric disorder: a 3T proton magnetic resonance spectroscopy study.
24778228 2014 Heterodimeric coiled-coil interactions of human GABAB receptor.
24682435 2015 GABAB receptors are expressed in human aortic smooth muscle cells and regulate the intracellular Ca(2+) concentration.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24305054 2013 Structural mechanism of ligand activation in human GABA(B) receptor.
24209778 2014 Altered gamma-aminobutyric acid type B receptor subunit 1 splicing in alcoholics.
24006265 2013 A novel human receptor involved in bitter tastant detection identified using Dictyostelium discoideum.
23391219 2013 GABBR1 has a HERV-W LTR in its regulatory region--a possible implication for schizophrenia.
23192081 2012 Activation of GABA(B) receptors inhibits protein kinase B/glycogen synthase kinase 3 signaling.
23007731 2013 Gamma-aminobutyric acid binds to GABAb receptor to inhibit cholangiocarcinoma cells growth via the JAK/STAT3 pathway.
22722631 2012 GABAB-ergic motor cortex dysfunction in SSADH deficiency.
22660477 2012 Structure and functional interaction of the extracellular domain of human GABA(B) receptor GBR2.
22613715 2012 ?-Aminobutyric acid type B (GABAB) receptor expression is needed for inhibition of N-type (Cav2.2) calcium channels by analgesic ?-conotoxins.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22321358 2012 Gamma-aminobutyric acid (GABA)-B receptor 1 in cerebellar cortex of essential tremor.
21932037 2012 On the origin of the triplet puzzle of homologies in receptor heteromers: immunoglobulin triplets in different types of receptors.
21621395 2011 GABBR1 gene polymorphism(G1465A)isassociated with temporal lobe epilepsy.
21303731 2011 Deficits in GABA(B) receptor system in schizophrenia and mood disorders: a postmortem study.
21124972 2010 Intron 4 containing novel GABAB1 isoforms impair GABAB receptor function.
20655490 2010 GABAB-GIRK2-mediated signaling in Down syndrome.
20655483 2010 GABA transporter GAT1: a crucial determinant of GABAB receptor activation in cortical circuits?
20655482 2010 GABAB receptor-mediated modulation of metabotropic glutamate signaling and synaptic plasticity in central neurons.
20655481 2010 GABAB receptor coupling to G-proteins and ion channels.
20655480 2010 Functional modulation of GABAB receptors by protein kinases and receptor trafficking.
20655479 2010 Mechanisms of GABAB receptor exocytosis, endocytosis, and degradation.
20655478 2010 Heterodimerization of the GABAB receptor-implications for GPCR signaling and drug discovery.
20557420 2010 Decreased GABA(B) receptors in the cingulate cortex and fusiform gyrus in autism.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20400944 2010 Native GABA(B) receptors are heteromultimers with a family of auxiliary subunits.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20036641 2010 GABA(B) receptor subunit 1 binds to proteins affected in 22q11 deletion syndrome.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19763258 2009 Association and interaction analyses of GABBR1 and GABBR2 with nicotine dependence in European- and African-American populations.
19664746 2009 Genome-wide association study reveals multiple nasopharyngeal carcinoma-associated loci within the HLA region at chromosome 6p21.3.
19327013 2009 Human cord blood-derived hematopoietic and neural-like stem/progenitor cells are attracted by the neurotransmitter GABA.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19052921 2009 GABA-B(1) receptors are coupled to the ERK1/2 MAP kinase pathway in the absence of GABA-B(2) subunits.
19002745 2009 Expression of GABA(B) receptors is altered in brains of subjects with autism.
18653317 2008 Association between the gamma-aminobutyric acid type B receptor 1 and 2 gene polymorphisms and mesial temporal lobe epilepsy in a Han Chinese population.
18403780 2008 Functional expression of GABAB receptors in airway epithelium.
18355961 2008 Analysis of LGI1 promoter sequence, PDYN and GABBR1 polymorphisms in sporadic and familial lateral temporal lobe epilepsy.
18255321 2008 GABABR1 (G1465A) gene variation and temporal lobe epilepsy controversy: new evidence.
18165688 2008 Direct detection of the interaction between recombinant soluble extracellular regions in the heterodimeric metabotropic gamma-aminobutyric acid receptor.
18098271 2008 GABA B receptor is a novel drug target for pancreatic cancer.
17971048 2008 SNP mapping and candidate gene sequencing in the class I region of the HLA complex: searching for multiple sclerosis susceptibility genes in Tasmanians.
17591780 2007 Complex formation with the Type B gamma-aminobutyric acid receptor affects the expression and signal transduction of the extracellular calcium-sensing receptor. Studies with HEK-293 cells and neurons.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17412563 2007 Systematic study of association of four GABAergic genes: glutamic acid decarboxylase 1 gene, glutamic acid decarboxylase 2 gene, GABA(B) receptor 1 gene and GABA(A) receptor subunit beta2 gene, with schizophrenia using a universal DNA microarray.
17264536 2007 Association of GABA(B)R1 receptor gene polymorphism with obstructive sleep apnea syndrome.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16829628 2006 Functional expression of the GABAB receptor in human airway smooth muscle.
16724110 2006 Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy.
16499773 2006 Lack of association between a GABA receptor 1 gene polymorphism and temporal lobe epilepsy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16176975 2005 Assembly-dependent surface targeting of the heterodimeric GABAB Receptor is controlled by COPI but not 14-3-3.
15946333 2005 GABA receptor 1 polymorphism (G1465A) and temporal lobe epilepsy.
15863499 2005 Asymmetric functioning of dimeric metabotropic glutamate receptors disclosed by positive allosteric modulators.
15857448 2005 Is variation in the GABA(B) receptor 1 gene associated with temporal lobe epilepsy?
15820424 2005 Possible association between the gamma-aminobutyric acid type B receptor 1 (GABBR1) gene and schizophrenia.
15799783 2005 The GABBR1 locus and the G1465A variant is not associated with temporal lobe epilepsy preceded by febrile seizures.
15759131 2005 Changes in hippocampal GABABR1 subunit expression in Alzheimer's patients: association with Braak staging.
15685626 2005 Evidence for the gamma-amino-butyric acid type B receptor 1 (GABBR1) gene as a susceptibility factor in obsessive-compulsive disorder.
15617512 2005 Subcellular distribution of GABA(B) receptor homo- and hetero-dimers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15482257 2005 Determination of the minimal functional ligand-binding domain of the GABAB1b receptor.
15474078 2004 Human follicular fluid stimulates the sperm acrosome reaction by interacting with the gamma-aminobutyric acid receptors.
15309313 2004 Screening for candidate gene regions in narcolepsy using a microsatellite based approach and pooled DNA.
15304491 2004 Structural analysis of the complement control protein (CCP) modules of GABA(B) receptor 1a: only one of the two CCP modules is compactly folded.
14978362 2004 Characterization of GABAB receptor in the human colon.
14966130 2004 Hetero-oligomerization between GABAA and GABAB receptors regulates GABAB receptor trafficking.
14961561 2004 Comparative cellular distribution of GABAA and GABAB receptors in the human basal ganglia: immunohistochemical colocalization of the alpha 1 subunit of the GABAA receptor, and the GABABR1 and GABABR2 receptor subunits.
14759258 2004 An unappreciated role for RNA surveillance.
14718537 2004 Marlin-1, a novel RNA-binding protein associates with GABA receptors.
14707142 2004 Phosphorylation and chronic agonist treatment atypically modulate GABAB receptor cell surface stability.
14643764 2003 GABA(B1a), GABA(B1b) AND GABA(B2) mRNA variants expression in hippocampus resected from patients with temporal lobe epilepsy.
14625043 2003 Increased expression of gamma-aminobutyric acid type B receptors in the hippocampus of patients with temporal lobe epilepsy.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12923192 2003 Gamma-hydroxybutyrate reduces mitogen-activated protein kinase phosphorylation via GABA B receptor activation in mouse frontal cortex and hippocampus.
12867983 2003 Analgesia and hyperalgesia from GABA-mediated modulation of the cerebral cortex.
12770685 2003 The gene encoding GABBR1 is not associated with childhood absence epilepsy in the Chinese Han population.
12645817 2003 Association analysis of exonic variants of the GABA(B)-receptor gene and alpha electroencephalogram voltage in normal subjects and alcohol-dependent patients.
12601092 2003 GABA(B) receptor 1 polymorphism (G1465A) is associated with temporal lobe epilepsy.
12555235 2003 Association of EEG coherence and an exonic GABA(B)R1 gene polymorphism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12115687 2002 GABABR1 receptor protein expression in human mesial temporal cortex: changes in temporal lobe epilepsy.
11844143 2001 Linkage disequilibrium of HLA-A11 and A1 with one of the polymorphisms of the gamma-aminobutyric acid receptor type B.
11178869 2001 Association of GABA(B) receptors and members of the 14-3-3 family of signaling proteins.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
11087824 2000 The GABAB receptor interacts directly with the related transcription factors CREB2 and ATFx.
10939334 2000 A trafficking checkpoint controls GABA(B) receptor heterodimerization.
10906333 2000 Characterization of gamma-aminobutyric acid receptor GABAB(1e), a GABAB(1) splice variant encoding a truncated receptor.
10773016 2000 Coexpression of full-length gamma-aminobutyric acid(B) (GABA(B)) receptors with truncated receptors and metabotropic glutamate receptor 4 supports the GABA(B) heterodimer as the functional receptor.
10587080 1999 Calcium sensing properties of the GABA(B) receptor.
10402495 1999 Association analysis of exonic variants of the gene encoding the GABAB receptor and idiopathic generalized epilepsy.
10328880 1999 Molecular identification of the human GABABR2: cell surface expression and coupling to adenylyl cyclase in the absence of GABABR1.
10075644 1999 Identification of a GABAB receptor subunit, gb2, required for functional GABAB receptor activity.
9933300 1998 Mapping, genomic structure, and polymorphisms of the human GABABR1 receptor gene: evaluation of its involvement in idiopathic generalized epilepsy.
9889352 1999 Molecular cloning of human GABABR1 and its tissue distribution.
9872744 1999 Role of heteromer formation in GABAB receptor function.
9872317 1998 GABA(B)-receptor subtypes assemble into functional heteromeric complexes.
9872316 1998 Heterodimerization is required for the formation of a functional GABA(B) receptor.
9872315 1998 GABA(B) receptors function as a heteromeric assembly of the subunits GABA(B)R1 and GABA(B)R2.
9844003 1998 Human gamma-aminobutyric acid type B receptors are differentially expressed and regulate inwardly rectifying K+ channels.
9798068 1998 Human gamma-aminobutyric acid B receptor gene: complementary DNA cloning, expression, chromosomal location, and genomic organization.
9753614 1998 GABA (gamma-amino-butyric acid) neurotransmission: identification and fine mapping of the human GABAB receptor gene.
9069281 1997 Expression cloning of GABA(B) receptors uncovers similarity to metabotropic glutamate receptors.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7927650 1994 Astrocytic GABA receptors.
7905214 1993 GABAB receptor antagonists: from synthesis to therapeutic applications.