Property Summary

NCBI Gene PubMed Count 56
PubMed Score 203.78
PubTator Score 28.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.237 3.1e-03
medulloblastoma, large-cell -1.100 6.0e-04
subependymal giant cell astrocytoma -1.155 4.9e-02
spina bifida -1.099 4.9e-02
ovarian cancer -2.400 5.8e-09

Gene RIF (23)

PMID Text
26284781 Using X-ray crystallography and NMR spectroscopy, the structural transition centered on the C-terminus of GATE-16 protein was identified.
25181299 describe a protocol for the reconstituted conjugation systems for mammalian Atg8 homologs in vitro using purified recombinant Atg proteins and liposomes.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24269818 these results suggest that TRPML3 plays a role in autophagosome maturation through the interaction with GATE16, by providing Ca(2+) in the fusion process.
23891751 low GABARAPL2/GATE-16 expression is associated with an immature myeloid leukemic phenotype and these proteins are necessary for neutrophil differentiation of APL cells
23112293 Legionella pneumophila could interfere with autophagy by using the bacterial effector protein RavZ to directly uncouple Atg8 proteins attached to phosphatidylethanolamine on autophagosome membranes. [RavZ]
23043107 ATG8 proteins act as scaffolds for assembly of the ULK complex at the phagophore
22959883 Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls
22885598 Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy
22421968 TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death.
22354992 identified 14 TBC domain-containing Rab GAPs that bind directly to ATG8 modifiers and that colocalize with LC3-positive autophagy membranes in cells
21684337 The level of GABARAPs is decreased in Lewy body disease.
21669198 ORP7 negatively regulates GS28 protein stability via sequestration of GATE-16, and may mediate the effect of 25-OH on GS28 and Golgi function.
21497758 The GATE-16 N termini in general and specific residues needed for the fusion activity are essential for the proteins role in autophagosome biogenesis.
21177865 Atg4B possessed the broadest spectrum against all substrates, followed by Atg4A for ATG8 substrates
20468064 Observational study of gene-disease association. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
19635843 HIV-1 Gag and Gag-derived proteins colocalize and interact with the autophagy factor LC3 (ATG8), and autophagy factor LC3 (ATG8) promotes productive Gag processing
19533740 analysis of human NSF possible binding mode to GABARAP and GATE-16
18776740 The autophagy-unrelated association of GFP-LC3 with protein aggregates is dependent on its interaction with p62.
18768753 The results indicate the essential role of the Atg8 system in the proper development of autophagic isolation membranes in mice.
18187620 Knockdown of GABA(A) receptor-associated protein-like 2 (GABARAPL2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16303767 Phosphatidylserine and phosphatidylethanolamine are targets of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16

AA Sequence

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL      1 - 70
PSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF                            71 - 117
//

Text Mined References (64)

PMID Year Title
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26284781 2015 Conformational Polymorphism in Autophagy-Related Protein GATE-16.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25181299 2014 In vitro assays of lipidation of Mammalian Atg8 homologs.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24668264 2014 Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.
24269818 2014 The Ca2+ channel TRPML3 specifically interacts with the mammalian ATG8 homologue GATE16 to regulate autophagy.
24089205 2013 Autophagy promotes primary ciliogenesis by removing OFD1 from centriolar satellites.
23891751 2013 Inhibition of GATE-16 attenuates ATRA-induced neutrophil differentiation of APL cells and interferes with autophagosome formation.
23209295 2013 Modulation of serines 17 and 24 in the LC3-interacting region of Bnip3 determines pro-survival mitophagy versus apoptosis.
23112293 2012 The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation.
23043107 2012 ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs.
22959883 2013 Alteration of autophagosomal proteins in the brain of multiple system atrophy.
22885598 2012 Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
22421968 2012 TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
22311637 2012 Identification of autophagosome-associated proteins and regulators by quantitative proteomic analysis and genetic screens.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21684337 2011 Alteration of autophagosomal proteins (LC3, GABARAP and GATE-16) in Lewy body disease.
21669198 2011 OSBP-related protein 7 interacts with GATE-16 and negatively regulates GS28 protein stability.
21617041 2011 Phosphorylation of the autophagy receptor optineurin restricts Salmonella growth.
21497758 2011 LC3 and GATE-16 N termini mediate membrane fusion processes required for autophagosome biogenesis.
21383079 2011 OATL1, a novel autophagosome-resident Rab33B-GAP, regulates autophagosomal maturation.
21269460 2011 Initial characterization of the human central proteome.
21177865 2011 Kinetics comparisons of mammalian Atg4 homologues indicate selective preferences toward diverse Atg8 substrates.
20562859 2010 Network organization of the human autophagy system.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20418806 2010 LC3 and GATE-16/GABARAP subfamilies are both essential yet act differently in autophagosome biogenesis.
20200478 2010 Nix, a receptor protein for mitophagy in mammals.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
20010802 2010 Nix is a selective autophagy receptor for mitochondrial clearance.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19533740 2009 Comparative modeling of human NSF reveals a possible binding mode of GABARAP and GATE-16.
19250911 2009 A role for NBR1 in autophagosomal degradation of ubiquitinated substrates.
19056683 2009 The TP53INP2 protein is required for autophagy in mammalian cells.
18776740 2008 Autophagy-independent incorporation of GFP-LC3 into protein aggregates is dependent on its interaction with p62/SQSTM1.
18768753 2008 The Atg8 conjugation system is indispensable for proper development of autophagic isolation membranes in mice.
17580304 2007 p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16303767 2006 Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15169837 2004 LC3, GABARAP and GATE16 localize to autophagosomal membrane depending on form-II formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12507496 2003 GATE-16 and GABARAP are authentic modifiers mediated by Apg7 and Apg3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473658 2003 The COOH terminus of GATE-16, an intra-Golgi transport modulator, is cleaved by the human cysteine protease HsApg4A.
11890701 2002 Murine Apg12p has a substrate preference for murine Apg7p over three Apg8p homologs.
11825910 2002 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.
11414770 2001 Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11146101 2000 Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation.
11096062 2001 The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10747018 2000 GATE-16, a membrane transport modulator, interacts with NSF and the Golgi v-SNARE GOS-28.