Property Summary

NCBI Gene PubMed Count 47
PubMed Score 198.25
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
gastric cancer -1.100 2.0e-03
hepatocellular carcinoma -1.300 1.2e-05
pancreatic cancer -1.300 1.1e-03
urothelial carcinoma -1.200 1.3e-02
astrocytic glioma -1.800 2.7e-03
posterior fossa group B ependymoma -2.600 2.1e-15
oligodendroglioma -1.700 1.8e-14
psoriasis -1.700 7.6e-10
glioblastoma -2.100 3.4e-06
osteosarcoma -2.452 3.3e-06
sonic hedgehog group medulloblastoma -3.800 2.9e-07
atypical teratoid / rhabdoid tumor -3.100 7.7e-09
medulloblastoma, large-cell -4.000 1.7e-05
primitive neuroectodermal tumor -2.200 7.6e-06
tuberculosis -2.000 4.3e-06
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
colon cancer -1.200 2.6e-02
lung cancer -1.300 8.9e-05
breast carcinoma -1.600 1.9e-05
lung adenocarcinoma -1.700 8.2e-12
adult high grade glioma -2.200 1.1e-04
pilocytic astrocytoma -1.500 5.0e-09
pancreatic carcinoma -1.300 1.1e-03
subependymal giant cell astrocytoma -1.970 7.1e-03
Endometriosis -1.326 1.7e-02
Breast cancer -1.600 2.3e-10
mucosa-associated lymphoid tissue lympho... 1.441 2.9e-02
ductal carcinoma in situ -1.500 5.2e-04
invasive ductal carcinoma -1.700 1.1e-03
acute myeloid leukemia 1.100 9.9e-03
ovarian cancer -3.200 1.1e-07
pituitary cancer -1.500 4.8e-04
dermatomyositis 1.500 3.3e-03

Gene RIF (16)

PMID Text
26474850 Our data demonstrated that a specific decrease of GABARAPL1 expression in breast cancers was associated with both DNA methylation and histone deacetylation and that CREB-1 recruitment on GABARAPL1
26050226 Androgen deprivation downregulates Gabarapl1 in an AR dependent manner, resulting in the increase of autophagy flux
24879149 GABARAPL1 plays an important role in cell proliferation, invasion, and autophagic flux, as well as in mitochondrial homeostasis and cellular metabolic programs in a breast cancer cell line.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24647565 Kaplan-Meier survival analysis showed a significant association between low GABARAPL1 expression and poor prognosis of HCC patients.
22959883 Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls
22120110 Data demonstrate that HSP90 interacts and protects GABARAPL1 from its degradation by the proteasome.
21893048 Atg8 interacting motif (AIM) in Stbd1 is necessary for GABARAPL1 binding.
21620860 Results indicate that the presence of a tryptophan residue in the LIR motif increases the binding affinity of GABARAPL-1/NBR1-LIR complex.
21597319 analysis of specific functions of GABARAPL1 [review]
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20197771 Gabarapl1 mRNA expression in breast tumours is a good indicator of the risk of recurrence, specifically in lymph nodes positive patients.
19549685 Caspase cleavage of Atg4D stimulates GABARAP-L1 processing and triggers mitochondrial targeting and apoptosis.
19001416 GEC1-kappa opioid receptor binding involves hydrophobic interactions: GEC1 has chaperone-like effect.
16431922 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor
14625090 Gec1/GABARAPL1 was more expressed than GABARAP in the central nervous system (CNS), while GABARAP was more expressed in endocrine glands.

AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHL      1 - 70
RPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK                            71 - 117
//

Text Mined References (54)

PMID Year Title
26474850 2015 The autophagy GABARAPL1 gene is epigenetically regulated in breast cancer models.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26050226 2015 Gabarapl1 mediates androgen-regulated autophagy in prostate cancer.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24879149 2014 The role of GABARAPL1/GEC1 in autophagic flux and mitochondrial quality control in MDA-MB-436 breast cancer cells.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24668264 2014 Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.
24647565 2014 Low expression of GABARAPL1 is associated with a poor outcome for patients with hepatocellular carcinoma.
23721406 2013 Arginine68 is an essential residue for the C-terminal cleavage of human Atg8 family proteins.
23690988 2013 Specific distribution of the autophagic protein GABARAPL1/GEC1 in the developing and adult mouse brain and identification of neuronal populations expressing GABARAPL1/GEC1.
23112293 2012 The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation.
23043107 2012 ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs.
22959883 2013 Alteration of autophagosomal proteins in the brain of multiple system atrophy.
22948227 2012 MAPK15/ERK8 stimulates autophagy by interacting with LC3 and GABARAP proteins.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
22120110 2012 Identification of HSP90 as a new GABARAPL1 (GEC1)-interacting protein.
21893048 2011 Starch-binding domain-containing protein 1 (Stbd1) and glycogen metabolism: Identification of the Atg8 family interacting motif (AIM) in Stbd1 required for interaction with GABARAPL1.
21620860 2011 Characterization of the interaction of GABARAPL-1 with the LIR motif of NBR1.
21617041 2011 Phosphorylation of the autophagy receptor optineurin restricts Salmonella growth.
21597319 2011 GABARAPL1 (GEC1): original or copycat?
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20810658 2010 Starch binding domain-containing protein 1/genethonin 1 is a novel participant in glycogen metabolism.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20562859 2010 Network organization of the human autophagy system.
20404487 2010 GABARAPL1 (GEC1) associates with autophagic vesicles.
20200478 2010 Nix, a receptor protein for mitophagy in mammals.
20197771 2010 High expression of gabarapl1 is associated with a better outcome for patients with lymph node-positive breast cancer.
20010802 2010 Nix is a selective autophagy receptor for mitochondrial clearance.
19549685 2009 Caspase cleavage of Atg4D stimulates GABARAP-L1 processing and triggers mitochondrial targeting and apoptosis.
19250911 2009 A role for NBR1 in autophagosomal degradation of ubiquitinated substrates.
19001416 2009 GEC1-kappa opioid receptor binding involves hydrophobic interactions: GEC1 has chaperone-like effect.
17580304 2007 p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy.
16704426 2006 Atg8L/Apg8L is the fourth mammalian modifier of mammalian Atg8 conjugation mediated by human Atg4B, Atg7 and Atg3.
16541075 2006 The finished DNA sequence of human chromosome 12.
16431922 2006 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292400 2004 Alfy, a novel FYVE-domain-containing protein associated with protein granules and autophagic membranes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625090 2003 Expression of gec1/GABARAPL1 versus GABARAP mRNAs in human: predominance of gec1/GABARAPL1 in the central nervous system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11414770 2001 Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein.
11374880 2001 A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9892355 1999 GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton.
8495796 1993 Identification and characterization of an early estrogen-regulated RNA in cultured guinea-pig endometrial cells.