Property Summary

NCBI Gene PubMed Count 115
PubMed Score 45.97
PubTator Score 115.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer 1.300 3.3e-03
psoriasis -1.600 1.7e-04
osteosarcoma -1.135 6.7e-03
chronic lymphosyte leukemia 1.400 3.9e-04
posterior fossa group A ependymoma 1.300 7.3e-06
glioblastoma 1.200 2.9e-05
sonic hedgehog group medulloblastoma 2.800 6.4e-06
atypical teratoid / rhabdoid tumor 1.100 1.0e-03
non-small cell lung cancer -1.500 1.9e-17
lung cancer -2.800 2.0e-05
colon cancer -2.200 3.0e-05
Breast cancer 2.300 2.6e-02
lung adenocarcinoma -1.100 5.0e-15
pediatric high grade glioma 1.200 3.2e-03
pilocytic astrocytoma 1.600 9.0e-07
pancreatic carcinoma 1.300 3.3e-03
lung carcinoma -1.600 4.8e-17
spina bifida -1.769 4.9e-02
progressive supranuclear palsy -1.300 3.3e-02
ulcerative colitis -1.400 8.9e-05
ovarian cancer -2.100 5.2e-07

 GO Component (1)

 GWAS Trait (1)

Gene RIF (63)

PMID Text
26183772 CVB3 targets host GAB1 to generate a GAB1-N1-174 fragment that enhances viral infectivity, at least in part, via activation of the ERK pathway
26090437 Gab1 protein was upregulated in cyanotic compared to acyanotic hearts suggesting that Gab1 upregulation is a component of the survival program initiated by hypoxia in cyanotic children
26014518 We found that expression of Gab1, VEGFR-2, and MMP-9 was highly and positively correlated with each other and with lymph node metastasis and TNM stage in intrahepatic cholangiocarcinoma tissues
25991585 Data demonstrate that miR-409-3p is a metastatic suppressor, and post-transcriptional inhibition of the oncoprotein GAB1 is one of its mechanisms of action.
25969544 EGFR-activated Src family kinases maintain GAB1-SHP2 complexes distal from EGFR.
25596749 Results suggest that Gab1 is an essential regulator of the EGF-mediated mTORC pathways and may potentially be used as a biomarker for urothelial carcinoma
25569504 Studied the pleckstrin homology (PH) domain of GAB1 for cancer treatment. Using homology models we derived, high-throughput virtual screening of five million compounds resulted in five hits which exhibited strong binding affinities to GAB1 PH domain.
25217982 This study suggests potential effects of SNPs of Gab1 on the onset and susceptibility of biliary tract cancer.
25144631 Endometrial GAB1 protein and mRNA expression are reduced in women with PCOS, suggesting that the endometrium of PCOS women have a defect in insulin signaling due to GAB1 down-regulation.
25078664 Galphai1/3 proteins lie downstream of KGFR, but upstream of Gab1-mediated activation of PI3K-AKT-mTORC1 signaling.
25041730 C-SH3 of Grb2 mediates the interaction with mutant Htt and this interaction being stronger could replace Gab1, with mutant Htt becoming the preferred partner. This would have immense effect on downstream signaling events.
24998422 Upregulations of Gab1 and Gab2 proteins associate with tumor progression of human gliomas.
24872569 Gab1 is an essential component of NRG1-type III signaling during peripheral nerve development.
24787006 miR-150 can influence the relative expression of GAB1 and FOXP1 and the signaling potential of the B-cell receptor
24391994 The combined GRB2 and GAB1 protein expression was significantly associated with aggressive tumor progression and poor prognosis in patients with hepatocellular carcinoma.
24374147 Gab1 as major target in linoleic acid-induced enhancement of tumorigenesis.
24312291 expression of Gab1, VEGFR-2, and MMP-9 are significantly related to the malignant biological behavior of hilar cholangiocarcinoma
23612964 the acquired substrate preference for GAB1 is critical for the ERBB2 mutant-induced oncogenesis.
23334917 Although Sos1 and Gab1 recognize two non-overlapping sites within the Grb2 adaptor, allostery promotes the formation of two distinct pools of Grb2-Sos1 and Grb2-Gab1 binary signaling complexes in lieu of a composite Sos1-Grb2-Gab1 ternary complex.
22915589 an anti-apoptotic role of caspase-cleaved GAB1 in HGF/SF-MET signaling.
22865653 GAB1 plays an important role as part of the mechanism of by which EGFR induces induced activation of the MAPK and AKT pathway.
22851227 these data underscore the critical roles of Gab1 and Gab2 in IL-22-mediated HaCaT cell proliferation, migration, and differentiation.
22751113 that aberrant Gab1 signaling can directly contribute to breast cancer progression, and that negative feedback sites in docking proteins can be targeted by oncogenic mutations.
22536782 Data show that bivalent binding drives the formation of the Grb2-Gab1 signaling complex in a noncooperative manner.
22366451 Met signals through a cortactin-Gab1 scaffold complex, to mediate invadopodia.
21782801 These data demonstrate that GAB1 is ubiquitinated by CBL and degraded by the proteasome, and plays a role in negative-feedback regulation of HGF/SF-MET signaling.
21282639 Gab1 is a critical upstream signaling component in VEGF-induced eNOS activation and tube formation, which is dependent on protein kinase A.
20723025 PECAM-1-mediated inhibition of GPVI-dependent platelet responses result from recruitment of SHP-2-p85 complexes to tyrosine-phosphorylated PECAM-1, which diminishes the association of PI3K with activatory signaling molecules Gab1 and LAT
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602450 We could not confirm a major association between Gab1 SNP (rs3805246) and the predisposition to H. pylori infection and CAG in this study populat
20602450 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20005866 The binding of Grb2 adaptor to its downstream partners Sos1 and Gab1 docker is under tight allosteric regulation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19881549 the phosphorylation of Gab1 by c-Src is important for hepatocyte growth factor -induced DNA synthesis
19665053 Gab1 couples PI3K-mediated Erythropoietin signals with the Ras/Erk pathway and plays an important role in erythropoietin receptor-mediated signal transduction involved in the proliferation and survival of erythroid cells.
19233262 These results underscore the non-redundant and essential roles of Gab1 and Gab2 in endothelial cells, and suggest major contributions of these proteins during in vivo angiogenesis.
18577518 the Gab1-SHP2-ERK1/2 signaling pathway comprises an inhibitory axis for IGF-I-dependent myogenic differentiation.
18192688 moderate level of Gab1 overexpression stimulated tumor growth
18003605 These results suggest that coupling of Grb2 to Gab1 mediates the hepatocyte growth factor-induced strong activation of the ERK pathway, which is required for the inhibition of HepG2 cell proliferation.
17625596 HGF signaling process from Gab1 to PI3K is negatively regulated by PKC-betaII, and its loss is critical for melanoma cells to gain invasive potential.
17211494 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17178724 Gab1 is a novel critical regulatory component of endothelial cell migration and capillary formation with a key role in the activation of VEGF-evoked signaling pathways required for angiogenesis
17145761 Bisindolylmaleimide I abolishes the FGF2-mediated association of Shp2 tyrosine phosphatase with Frs2 and Gab1.
16849525 Crk adaptor protein is required for the sustained phosphorylation of c-Met-docking protein Grb2-associated binder 1 (Gab1) in response to HGF, leading to the enhanced cell motility of human synovial sarcoma cell lines SYO-1, HS-SY-II, and Fuji.
16787925 Gab1 appears as a primary actor in coupling VEGFR-2 to PI3K/Akt, recruited through an amplification loop involving PtdIns(3,4,5)P3 and its PH domain
16687399 By amplifying positive interactions between survival and mitogenic pathways, GAB1 plays the critical role in cell proliferation and tumorigenesis.
15952937 Gab2 plays a pivotal role in the EGF-induced ERK activation pathway and that it can complement the function of Gab1 in the EGF signalling pathway; Gab1 and Gab2 are critical signalling threshold proteins for ERK activation by EGF.
15940252 RAI associates with the Grb 2-associated binder 1 (GAB 1) adapter. This association is constitutive, but, in the presence of RET oncoproteins, both RAI and GAB 1 are tyrosine-phosphorylated, and the stoichiometry of this interaction remarkably increases
15665327 Gab1 tyrosine phosphorylation is stimulated by flow shear stress to mediate protein kinase B and endothelial nitric-oxide synthase activation in endothelial cells
15379552 extracellular signal-regulated kinases 1/2 modulate insulin action via Gab1 by targeting serine and threonine residues beside YXXM motifs
15351743 coupling of Gab1 to PI3K is important for biological responses in RET-expressing cells
15010462 Hck-mediated phosphorylation of Gab1 and Gab2 docking proteins in IL-6-induced proliferation and survival of multiple myeloma cells.
14701753 SHP-2/Gab1 association is critical for linking EGFR to NF-kappaB transcriptional activity via the PI3-kinase/Akt signaling axis in glioblastoma cells
14665621 results reveal that Gab1 protein recruits SHP2 protein tyrosine phosphatase to dephosphorylate paxillin
12855672 Gab1-SHP2 interaction plays a crucial role in gp130-dependent longitudinal elongation of cardiomyoctes and cardiac hypertrophy through activation of ERK5
12808090 Gab1 is an integrator of cell death versus cell survival signals in oxidative stress
12766170 Gab1 and the Met receptor interact in a novel manner, such that the activated kinase domain of Met and the negative charge of phosphotyrosine 1349 engage the Gab1 MBD as an extended peptide ligand
12370245 Results indicate that Gab1 and SHP-2 promote the undifferentiated epidermal cell state by facilitating Ras/MAPK signaling.
11896055 ERK negatively regulates the epidermal growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase
11701952 comparative FISH mapping of Gab1 and Gab2 genes in human, mouse and rat
11606067 Unique phosphorylation mechanism of Gab1 using PI 3-kinase as an adaptor protein.

AA Sequence

MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA      1 - 70
GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL     71 - 140
AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE    141 - 210
TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA    211 - 280
DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP    281 - 350
AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL    351 - 420
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP    421 - 490
PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARD    491 - 560
SSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL    561 - 630
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK          631 - 694
//

Text Mined References (121)

PMID Year Title
26183772 2015 Enhanced enteroviral infectivity via viral protease-mediated cleavage of Grb2-associated binder 1.
26090437 2015 Gab1 Is Modulated by Chronic Hypoxia in Children with Cyanotic Congenital Heart Defect and Its Overexpression Reduces Apoptosis in Rat Neonatal Cardiomyocytes.
26014518 2015 Gab1 regulates proliferation and migration through the PI3K/Akt signaling pathway in intrahepatic cholangiocarcinoma.
25991585 2015 MicroRNA-409-3p suppresses colorectal cancer invasion and metastasis partly by targeting GAB1 expression.
25969544 2015 EGFR-activated Src family kinases maintain GAB1-SHP2 complexes distal from EGFR.
25596749 2015 Gab1 is essential for membrane translocation, activity and integrity of mTORCs after EGF stimulation in urothelial cell carcinoma.
25569504 2015 Novel inhibitors induce large conformational changes of GAB1 pleckstrin homology domain and kill breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25217982 2014 Essential role of polymorphism of Gab1, EGFR, and EGF for the susceptibility of biliary tract cancer.
25144631 2014 Characterization of GAB1 expression over the menstrual cycle in women with and without polycystic ovarian syndrome provides a new insight into its pathophysiology.
25078664 2015 Requirement of G?i1/3-Gab1 signaling complex for keratinocyte growth factor-induced PI3K-AKT-mTORC1 activation.
25041730 2014 Mutant huntingtin replaces Gab1 and interacts with C-terminal SH3 domain of growth factor receptor binding protein 2 (Grb2).
24998422 2014 Combined detection of Gab1 and Gab2 expression predicts clinical outcome of patients with glioma.
24872569 2014 Grb2-associated binder-1 is required for neuregulin-1-induced peripheral nerve myelination.
24787006 2014 miR-150 influences B-cell receptor signaling in chronic lymphocytic leukemia by regulating expression of GAB1 and FOXP1.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24391994 2013 Identification of GRB2 and GAB1 coexpression as an unfavorable prognostic factor for hepatocellular carcinoma by a combination of expression profile and network analysis.
24374147 2014 Key roles for GRB2-associated-binding protein 1, phosphatidylinositol-3-kinase, cyclooxygenase 2, prostaglandin E2 and transforming growth factor alpha in linoleic acid-induced upregulation of lung and breast cancer cell growth.
24312291 2013 Down-regulation of Gab1 inhibits cell proliferation and migration in hilar cholangiocarcinoma.
23612964 2013 Acquired substrate preference for GAB1 protein bestows transforming activity to ERBB2 kinase lung cancer mutants.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23334917 2013 Allostery mediates ligand binding to Grb2 adaptor in a mutually exclusive manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22915589 2012 Anti-apoptotic role of caspase-cleaved GAB1 adaptor protein in hepatocyte growth factor/scatter factor-MET receptor protein signaling.
22865653 2013 Role of GRB2-associated binder 1 in epidermal growth factor receptor-induced signaling in head and neck squamous cell carcinoma.
22851227 2012 Participation of Gab1 and Gab2 in IL-22-mediated keratinocyte proliferation, migration, and differentiation.
22751113 2013 Functional characterization of cancer-associated Gab1 mutations.
22536782 2012 Bivalent binding drives the formation of the Grb2-Gab1 signaling complex in a noncooperative manner.
22366451 2012 Met receptor tyrosine kinase signals through a cortactin-Gab1 scaffold complex, to mediate invadopodia.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21804548 2011 Genome-wide association study identifies three new susceptibility loci for adult asthma in the Japanese population.
21782801 2011 Degradation of the GAB1 adaptor by the ubiquitin-proteasome pathway hampers HGF/SF-MET signaling.
21282639 2011 Grb-2-associated binder 1 (Gab1) regulates postnatal ischemic and VEGF-induced angiogenesis through the protein kinase A-endothelial NOS pathway.
21278788 2011 Translationally controlled tumor protein induces human breast epithelial cell transformation through the activation of Src.
20936779 2010 A human MAP kinase interactome.
20723025 2010 Platelet endothelial cell adhesion molecule-1 regulates collagen-stimulated platelet function by modulating the association of phosphatidylinositol 3-kinase with Grb-2-associated binding protein-1 and linker for activation of T cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602450 2010 Grb2-associated binder 1 (Gab1) genetic polymorphism, Helicobacter pylori infection, and chronic atrophic gastritis among older adults from Germany.
20308328 2010 Functional effects of PTPN11 (SHP2) mutations causing LEOPARD syndrome on epidermal growth factor-induced phosphoinositide 3-kinase/AKT/glycogen synthase kinase 3beta signaling.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20005866 2010 Assembly of the Sos1-Grb2-Gab1 ternary signaling complex is under allosteric control.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19881549 2010 Differential phosphorylation of the docking protein Gab1 by c-Src and the hepatocyte growth factor receptor regulates different aspects of cell functions.
19665053 2009 Gab1 transduces PI3K-mediated erythropoietin signals to the Erk pathway and regulates erythropoietin-dependent proliferation and survival of erythroid cells.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19233262 2009 Non-redundant roles of the Gab1 and Gab2 scaffolding adapters in VEGF-mediated signalling, migration, and survival of endothelial cells.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18577518 2008 Interaction of scaffolding adaptor protein Gab1 with tyrosine phosphatase SHP2 negatively regulates IGF-I-dependent myogenic differentiation via the ERK1/2 signaling pathway.
18192688 2008 Gab1 but not Grb2 mediates tumor progression in Met overexpressing colorectal cancer cells.
18003605 2008 Coupling of Grb2 to Gab1 mediates hepatocyte growth factor-induced high intensity ERK signal required for inhibition of HepG2 hepatoma cell proliferation.
17625596 2008 Protein kinase C-betaII represses hepatocyte growth factor-induced invasion by preventing the association of adapter protein Gab1 and phosphatidylinositol 3-kinase in melanoma cells.
17211494 2006 Grb2-associated binder 1 polymorphism was associated with the risk of Helicobactor pylori infection and gastric atrophy.
17178724 2007 The scaffolding adapter Gab1 mediates vascular endothelial growth factor signaling and is required for endothelial cell migration and capillary formation.
17145761 2007 Bisindolylmaleimide I suppresses fibroblast growth factor-mediated activation of Erk MAP kinase in chondrocytes by preventing Shp2 association with the Frs2 and Gab1 adaptor proteins.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16849525 2006 Adaptor molecule Crk is required for sustained phosphorylation of Grb2-associated binder 1 and hepatocyte growth factor-induced cell motility of human synovial sarcoma cell lines.
16787925 2006 The adaptor protein Gab1 couples the stimulation of vascular endothelial growth factor receptor-2 to the activation of phosphoinositide 3-kinase.
16687399 2006 Scaffolding protein Grb2-associated binder 1 sustains epidermal growth factor-induced mitogenic and survival signaling by multiple positive feedback loops.
16638574 2006 Reduced phosphatase activity of SHP-2 in LEOPARD syndrome: consequences for PI3K binding on Gab1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15952937 2005 Participation of both Gab1 and Gab2 in the activation of the ERK/MAPK pathway by epidermal growth factor.
15940252 2005 RAI(ShcC/N-Shc)-dependent recruitment of GAB 1 to RET oncoproteins potentiates PI 3-K signalling in thyroid tumors.
15863030 2005 Cellular signaling by fibroblast growth factor receptors.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15665327 2005 Flow shear stress stimulates Gab1 tyrosine phosphorylation to mediate protein kinase B and endothelial nitric-oxide synthase activation in endothelial cells.
15574420 2005 A novel role for Gab1 and SHP2 in epidermal growth factor-induced Ras activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15379552 2004 Identification of major ERK-related phosphorylation sites in Gab1.
15351743 2004 Biochemical and biological responses induced by coupling of Gab1 to phosphatidylinositol 3-kinase in RET-expressing cells.
15010462 2004 Critical role for hematopoietic cell kinase (Hck)-mediated phosphorylation of Gab1 and Gab2 docking proteins in interleukin 6-induced proliferation and survival of multiple myeloma cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701753 2004 Distinct domains in the SHP-2 phosphatase differentially regulate epidermal growth factor receptor/NF-kappaB activation through Gab1 in glioblastoma cells.
14665621 2004 Roles of Gab1 and SHP2 in paxillin tyrosine dephosphorylation and Src activation in response to epidermal growth factor.
14560030 2003 Molecular mechanism for a role of SHP2 in epidermal growth factor receptor signaling.
12855672 2003 Activation of gp130 transduces hypertrophic signal through interaction of scaffolding/docking protein Gab1 with tyrosine phosphatase SHP2 in cardiomyocytes.
12808090 2003 Gab1 is an integrator of cell death versus cell survival signals in oxidative stress.
12766170 2003 Grb2-independent recruitment of Gab1 requires the C-terminal lobe and structural integrity of the Met receptor kinase domain.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12486104 2002 Non-T cell activation linker (NTAL): a transmembrane adaptor protein involved in immunoreceptor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475979 2003 Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1.
12370245 2002 Gab1 and SHP-2 promote Ras/MAPK regulation of epidermal growth and differentiation.
12138161 2002 Crk synergizes with epidermal growth factor for epithelial invasion and morphogenesis and is required for the met morphogenic program.
12065326 2002 Insulin-like growth factor-1 enhances inflammatory responses in endothelial cells: role of Gab1 and MEKK3 in TNF-alpha-induced c-Jun and NF-kappaB activation and adhesion molecule expression.
11960376 2002 UCS15A, a novel small molecule, SH3 domain-mediated protein-protein interaction blocking drug.
11940581 2002 Protein kinase C-alpha and protein kinase C-epsilon are required for Grb2-associated binder-1 tyrosine phosphorylation in response to platelet-derived growth factor.
11896055 2002 ERK negatively regulates the epidermal growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase.
11707404 2001 ShcA and Grb2 mediate polyoma middle T antigen-induced endothelial transformation and Gab1 tyrosine phosphorylation.
11701952 2001 Comparative FISH mapping of Gab1 and Gab2 genes in human, mouse and rat.
11606067 2001 Unique phosphorylation mechanism of Gab1 using PI 3-kinase as an adaptor protein.
11507676 2001 Potential role of Gab1 and phospholipase C-gamma in osmotic shock-induced glucose uptake in 3T3-L1 adipocytes.
11453982 2001 Co-clustering of Fcgamma and B cell receptors induces dephosphorylation of the Grb2-associated binder 1 docking protein.
11432805 2001 Identification of epidermal growth factor receptor- Grb2-associated binder-1-SHP-2 complex formation and its functional loss during neoplastic cell progression.
11360177 2001 Identification of SNT/FRS2 docking site on RET receptor tyrosine kinase and its role for signal transduction.
11353842 2001 Stimulation of phosphatidylinositol 3-kinase by fibroblast growth factor receptors is mediated by coordinated recruitment of multiple docking proteins.
11323411 2001 Phosphotyrosines 627 and 659 of Gab1 constitute a bisphosphoryl tyrosine-based activation motif (BTAM) conferring binding and activation of SHP2.
11314042 2001 The C-terminal SH3 domain of the adapter protein Grb2 binds with high affinity to sequences in Gab1 and SLP-76 which lack the SH3-typical P-x-x-P core motif.
11278704 2001 The Gab1 docking protein links the b cell antigen receptor to the phosphatidylinositol 3-kinase/Akt signaling pathway and to the SHP2 tyrosine phosphatase.
11134009 2001 A critical role for phosphoinositide 3-kinase upstream of Gab1 and SHP2 in the activation of ras and mitogen-activated protein kinases by epidermal growth factor.
10995442 2000 Essential role of Gab1 for signaling by the c-Met receptor in vivo.
10978177 2000 Identification of major tyrosine phosphorylation sites in the human insulin receptor substrate Gab-1 by insulin receptor kinase in vitro.
10913131 2000 Identification of an atypical Grb2 carboxyl-terminal SH3 domain binding site in Gab docking proteins reveals Grb2-dependent and -independent recruitment of Gab1 to receptor tyrosine kinases.
10753869 2000 Signaling of hepatocyte growth factor/scatter factor (HGF) to the small GTPase Rap1 via the large docking protein Gab1 and the adapter protein CRKL.
10747014 2000 gC1q-R/p32, a C1q-binding protein, is a receptor for the InlB invasion protein of Listeria monocytogenes.
10734310 2000 Sustained recruitment of phospholipase C-gamma to Gab1 is required for HGF-induced branching tubulogenesis.
10648629 2000 A novel positive feedback loop mediated by the docking protein Gab1 and phosphatidylinositol 3-kinase in epidermal growth factor receptor signaling.
10068651 1999 Gab-family adapter proteins act downstream of cytokine and growth factor receptors and T- and B-cell antigen receptors.
10022866 1999 The Gab1 PH domain is required for localization of Gab1 at sites of cell-cell contact and epithelial morphogenesis downstream from the met receptor tyrosine kinase.
9890893 1999 Identification of tyrosine phosphorylation sites in human Gab-1 protein by EGF receptor kinase in vitro.
9878555 1998 Molecular cloning and expression of human grap-2, a novel leukocyte-specific SH2- and SH3-containing adaptor-like protein that binds to gab-1.
9658397 1998 Determination of Gab1 (Grb2-associated binder-1) interaction with insulin receptor-signaling molecules.
9356464 1997 Grb2-associated binder-1 mediates phosphatidylinositol 3-kinase activation and the promotion of cell survival by nerve growth factor.
9252406 1997 Association of the multisubstrate docking protein Gab1 with the hepatocyte growth factor receptor requires a functional Grb2 binding site involving tyrosine 1356.
9242692 1997 Efficient cellular transformation by the Met oncoprotein requires a functional Grb2 binding site and correlates with phosphorylation of the Grb2-associated proteins, Cbl and Gab1.
9045692 1997 Signal transduction pathway of human fibroblast growth factor receptor 3. Identification of a novel 66-kDa phosphoprotein.
8596638 1996 A Grb2-associated docking protein in EGF- and insulin-receptor signalling.