Property Summary

NCBI Gene PubMed Count 293
PubMed Score 10.48
PubTator Score 6611.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.900 5.6e-04
glioblastoma 1.500 8.7e-04
tuberculosis 1.900 1.4e-07
lung cancer 1.300 5.8e-03
subependymal giant cell astrocytoma 1.181 2.8e-02
Breast cancer 1.500 2.4e-07
invasive ductal carcinoma 1.200 2.1e-02
acute myeloid leukemia 1.200 2.8e-03

Protein-protein Interaction (8)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504792 confirmatory 39 / 0 / 548 Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay for Inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase
588414 confirmatory 0 / 0 / 68 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay
588672 confirmatory 0 / 0 / 30 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay - Set 2
602130 confirmatory 0 / 0 / 24 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay - Set 3
602424 confirmatory 0 / 0 / 17 SAR analysis of small molecule inhibitors of Plasmodium falciparum Glucose-6-Phosphate Dehydrogenase using a Human Glucose-6-Phosphate Dehydrogenase Dose Response Selectivity Assay - Set 4

Gene RIF (252)

PMID Text
27097228 G6PD deficiency affects the cellular inflammatory response and the decreased TNF-alpha-mediated antiviral response in G6PD-kd A549 cells is a result of dysregulated NOX/MAPK/NF-kappaB/COX-2 signaling
26976705 Transgenic mice moderately overexpressing G6PD have higher levels of NADPH, lower levels of ROS-derived damage, and better protection from ageing-associated functional decline, including extended median lifespan in females.
26840990 study demonstrated that G6PD molecular deficiency was not associated either with clinical ischemic stroke
26829728 Mutation of G6PD is associated with G6PD deficiency in Chinese population.
26823837 This is the first report of G6PD deficiency among Chinese Hakka population in Jiangxi province.
26694452 These findings suggest that the increased susceptibility of the G6PD-knockdown cells to viral infection was due to impaired NF-kappaB signaling and antiviral response mediated by HSCARG.
26621836 Data indicate a tumor suppressor-like function of Bcl-2 associated athanogene 3 (BAG3) via direct interaction with glucose 6 phosphate dehydrogenase (G6PD) in hepatocellular carcinomas (HCCs) at the cellular level.
26607846 Overexpression of G6PD is associated with high risks of recurrent metastasis in primary breast carcinoma.
26399441 G6PD glycosylation is increased in human lung cancers. Glycosylation activates G6PD activity and increases glucose flux through the PPP, thereby providing precursors for nucleotide and lipid biosynthesis, and reducing equivalents for antioxidant defense.
26139767 G6PD deficiency is an example of balanced polymorphism, in which high rate of mortality caused by this disorder is offset by the protection that it offers against Plasmodium falciparum malaria
26004559 To understand the sporadic Alzheimer's disease, the writer of this paper thinks that, looking into a crystal ball might not yield much of a benefit but glucose-6-phosphate dehydrogenase deficiency could effortlessly give some clues.
25979194 differential expression in children with allergic asthma
25885177 Studied G6PD mutations present in a Sri Lankan population and their association with uncomplicated malaria.
25818003 G6PD, GGCT, IDH1, isocitrate dehydrogenase 2 (NADP+,mitochondrial) (IDH2) and glutathione S-transferase pi 1(GSTP1), five of the critical components of GSH pathway, contribute to chemoresistance.
25671784 Our study also demonstrates that the much-needed large-scale studies of severe malaria and G6PD enzymatic function across African populations require the identification and analysis of the full repertoire of G6PD genetic markers.
25633909 Proteomics results showed that G6PD was highly expressed in cervical cancer cells and its down regulation reduced reduced the capacity of HeLa cells to migrate and invade in vitro.
25616277 G6PD expressions in the HR-HPV + human CC tissues and cell lines play an important role in tumor growth and proliferation.
25536053 The population from Myanmar living in the study area has a high frequency of G6PD deficiency ranging from 9% to 18%.
25407525 These results show that the location of the mutation affects the catalytic properties, stability and structure of G6PD and that these changes are closely associated with the clinical presentation of its deficiency.
25297600 Studies suggest that the glucose-6-phosphate dehydrogenase (G6PD) deficiency genetic screening should be performed prior to assisted reproduction.
25261933 The main African form of G6PD deficiency reduces the risk of cerebral malaria but increases the risk of severe malarial anemia.
25261071 Adequate hemodialysis in correcting anemia had a benificial effect by enhancing the erythrocyte G6PD activity in patients.
25246627 G6PD-deficient neonates had a higher risk of neonatal hyperbilirubinemia compared to controls.
25201310 c.376A>G (rs1050829) augments 202AG heterozygote risk for deficiency trait by two-fold.
25189226 A novel G6PD mutation named Mexico DF(193A>G) (rs199474830), which probably results in a damaging functional effect in glucose-6-phosphate dehydrogenase deficiency.
25169987 The G6PD A- mutation (G202A and A376G) does not appear to have a role in G6PD deficiency.
25015414 53 G6PD polymorphisms, including 202/376, were genotyped across the 712 samples from Dogon and Fulani people. Association of these polymorphisms and mild malaria was assessed in both ethnic groups using genotypic and haplotypic statistical tests.
24994855 G6PD may be a novel target in future treatment of HBV-associated cancer of the liver.
24958328 Heterozygotes with hypermethylation of specific CpG sites in the G6PD promoter and preferential X-inactivation of the wild-type allele were at risk of enzyme deficiency.
24853873 No G6PD deficiency was observed using phenotypic- or genetic-based tests in individuals residing in vivax malaria endemic regions in the ROK.
24805191 We show that HDAC inhibitors selectively enhance transcription of glucose 6-phosphate dehydrogenase
24769394 Regulation of G6PD acetylation by SIRT2 and KAT9 modulates NADPH homeostasis and cell survival during oxidative stress.
24636884 The G6PD-deficient erythrocytes were severely compromised in their ability to recycle oxidized Prx2.
24615128 Our results support the protective effect in G6PD A- heterozygous females and suggest that homozygotes might be more susceptible to severe malaria attacks.
24586352 The Mediterranean variant of G6PD, 563C>T, is common in many ethnic groups in Afghanistan, indicating that screening for G6PD deficiency is required in all individuals before radical treatment of P. vivax with primaquine.
24460025 Male G6PD C563T hemizygotes suffer from G6PD deficiency and severe neonatal jaundice.
24270845 G6PD is the major proliferative target of TAp73 in the human lung cancer H1299 cells.
24223971 the impact of bacterial infection in G6PD-deficient cells
24146346 Here, human G6PD was heterologously expressed in Escherichia coli and purified by immobilized metal affinity chromatography in a single chromatographic step.
24134566 Identification of G6PD-deficient blood donors and characterization of molecular variants would prevent the transfusion of G6PD-deficient erythrocytes when the hemolytic complications could be relevant, especially for high risk patients.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of glucose-6-phosphate dehydrogenase (G6PD) expression by HIV-1 Vpr in Vpr transduced macrophages
23742107 our findings reveal for the first time a proteome-wide dysregulation by G6PD depletion under the condition without exogenous oxidant challenge, and we suggest a novel association of G6PD activity with AFB-related xenobiotic metabolism.
23693134 Variant G6PD levels promote tumor cell proliferation or apoptosis via the STAT3/5 pathway in the human melanoma xenograft mouse model.
23640907 Neonates with Malay ethnicity and G6PD mutation were at risk for hyperbilirubinemia.
23631859 hnRNP K is a nutrient regulated splicing factor responsible for the inhibition of the splicing of G6PD during starvation
23569738 G6PD deficiency is not related to jaundiced newborns.
23485169 Risk associated with the G6PD deficient phenotype was not significantly decreased. However, when stratifying the analysis by G6PD phenotype, no variation in risk was observed among subjects with normal G6PD enzyme activity
23389243 biochemical association of an SNP in 3'-UTR of G6PD gene and the possible role of mRNA secondary structure.
23275194 These results indicated that High-resolution DNA melting method was a major technical advance for G6PD mutations screening.
23233666 Serine arginine splicing factor 3 is involved in enhanced splicing of glucose-6-phosphate dehydrogenase RNA in response to nutrients and hormones in liver
23185302 These studies illustrate that increasing G6PD activity restores redox balance in endothelial cells exposed to high glucose.
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of glucose-6-phosphate dehydrogenase (G6PD) expression by HIV-1 Vpr in Vpr transduced macrophages
23146719 The frequency of 2 SNPS(G202A and A376G) in the Shagia and Manasir tribes of Sudanese Arabs from the region of the 4th Nile cataract were determined, providing insight into the spread of these SNPS in Africa.
23144702 Data indicate that single nucleotide polymorphisms (SNPs) in two X-linked genes, glucose-6-phosphate dehydrogenase (G6PD) and CD40L, were associated with altered risk of severe malaria in females but not in males.
23065279 Association between genotype and clinical features in Glucose-6-phosphate dehydrogenase deficiency in Tunisia.
23023104 The most potent hG6PD inhibitors presented IC(50) values of <4 microM.
22963789 2 novel missense class III variants were identified (c.920A>C: p.307Gln>Pro and c.968T>C: p.323 Leu>Pro)& designated G6PD Tunis & G6PD Nefza. 14 other genotypes were found among 293 Tunisian G6PD deficiency patients.
22958163 Intracranial vasculopathy was observed in a minority of children with sickle cell anaemia (SCA), and when present, was associated with G6PD status in males and Silent cerebral infarct (SCI).
22906837 This is the first report of G6PD Santamaria and Cairo among our Jordanian population.
22906047 Infants with G6PD c.563C > T variant developed jaundice earlier than infants with normal G6PD enzyme levels. Compared to G6PD normal infants, G6PD c.563C > T carrying infants had significantly low G6PD activity.
22848499 G6PD activity antagonizes the cytotoxicity of 8-substituted adenosine analogues and suggests that administration of these agents to patients with B-cell malignancies exhibiting normal levels of G6PD expression may be particularly efficacious.
22770933 G6PD Beverly Hills(c.1160A) mutation, and a novel G6PD missense mutation c.536G>A (Ser179Asn), G6PD "Gaza" have been found in glucose-6-phosphate dehydrogenase gene in Gaza Strip Palestinian children.
22768742 Deficiencies of erythrocytic G6PD in Uzbekistan are marked with diverse pathological phenotypes.
22552160 Using PCR-SSCP of coding regions followed by direct sequencing of abnormal pattern, three new mutations were detected in G6PD in Tunisian population.
22537951 UGT1A1 Gly71Arg and G6PD gene mutations may be involved in the development of neonatal unconjugated hyperbilirubinemia.
22431005 G6PD is under complex regulatory control and of central importance to many cellular processes. [Review]
22364808 The Mediterranean mutation c.563T, while common among G6PD deficient Gaza Strip Palestinians and closely linked with the G6PD c.1311T polymorphism, does not account for most of the G6PD mutations in Gaza Strip population.
22307442 Case Report: novel GLA mutation in mother/daughter/son with Fabry disease and glucose-6-phosphate dehydrogenase deficiency.
22165289 Enzyme kinetics and molecular modeling studies of G6PD(Mahidol) associated with acute hemolytic anemia
22139979 Novel mutations in the glucose-6-phosphate dehydrogenase gene isoforms have been described among ethnically diverse French patients with the glucose 6-phosphate dehydrogenase deficiency.
22117603 analysis of mutations in homozygous sickle cell anemia and glucose-6-phosphate dehydrogenase deficiency [case report]
22012600 overexpression of G6PD is closely related to progression of gastric cancer, and might be regarded as an independent predictor of poor prognosis for gastric cancer.
21549219 G6PD A- carriers had a lower increase of IgG3 levels to plasmodium falciparum MSP2 antigen during the transmission season than the noncarriers
21507207 Data show that 563C-T was the commonest G6PD variant, while 1003A-G and 131C-G were less-frequent genetic variants of G6PD in Pakistani population.
21507164 The frequency of G6PD deficiency is higher among the Negrito Orang Asli than other Malaysian races and might be a result of genetic drift within this isolated group.
21397531 Molecular studies revealed heterozygosity for an in-frame 18-bp deletion, mapping to exon 10 leading to a deletion of 6 residues, 362-367 (LNERKA), which is a novel G6PD class 1 variant, G6PD Tondela
21376267 Data suggest that HIV-positive G6PD-deficient subjects due to reduced intracellular GSH levels may be more prone to the development of AIDS.
21376116 erythrocytes from the common African variant G6PD A- were used to analyze by redox proteomics the major oxidative changes occurring in host membrane proteins during intraerythrocytic development of Plasmodium falciparum, the most lethal malaria parasite
21302115 Data report two families with novel mutations of glucose-6-phosphate dehydrogenase causing chronic nonspherocytic hemolytic anemia.
21205543 G6PD(C563T) Mediterranean mutation accounted for 65.6% of favism in Jordan. There is likely to be another G6PD deficiency variant in acute hemolytic crisis (favism).
21180140 G6PD contributes to replenish intracellular GSH and is a critical factor regulating GSH levels during oxidative stress.
21125776 The interaction effect of G-6-PD deficiency with sickle cell gene (trait) in lowering the red cell indices was more marked in females than in males
20949590 Glucose-6-phosphate dehydrogenase mutation is associated with severe neonatal hyperbilirubinemia and cholestasis.
20927393 Plasmodium falciparum induced its own G6PD gene in G6PD-deficient erythrocytes.
20713184 in Indian population, study identified 1 new exonic variant predicted to result in G6PD deficiency; results provide indication of weak negative selection and reveal signals of recent positive selection for Orissa and Coimbra mutation bearing haplotypes
20684792 Results of the survey indicate that G6PD deficiency is prevalent in Isabel Province
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20621077 three families carrying G6PD mutations unusual for Italian population
20602793 Observational study of genotype prevalence. (HuGE Navigator)
20582980 A novel missense mutation (G473A), predicting a Cys-to-Tyr substitution at codon 158, was identified in a male infant patient and confirmed in his mother
20528626 haplotypes linked to G6PD genotypes in India defined by studying intragenic RFLPs in G6PD deficient and normal chromosomes;only 4 haplotypes were observed, indicating linkage disequilibrium; all G6PD deficient mutations associated with haplotype I or VII
20520804 Observational study of gene-disease association. (HuGE Navigator)
20514852 Observational study of gene-disease association. (HuGE Navigator)
20507315 Observational study of gene-disease association. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20447239 frequency of G6PD gene mutations in G6PD deficient cases in Saudi Arabia; 2 mutations were resolved in exon 6- Mediterranean and Sibari; no mutation was detected in exon 7; frequency of exon 6 mutations responsible for G6PD deficiency was 50.1%
20236109 determined the frequency and spectrum of G6PD mutations in Saudi patients
20203002 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20200584 This is the first report of a G6PD-deficient Chinese patient in the category of class I
20118060 Low glucose-6-phosphate dehydrogenase is associated with severe hemolysis.
20113600 G-6-PD gene mutations alone may not contribute to the development of acute bilirubin encephalopathy and the changes of peak bilirubin concentration 72 hrs after birth.
20113600 Observational study of gene-disease association. (HuGE Navigator)
20032314 High-glucose-mediated decrease in G6PD activity may provide a mechanistic explanation for the gradual loss of beta cells in patients with diabetes.
20017397 The regulation of glucose-6-phosphate dehydrogenase and glycogen synthase activities by insulin superfamily peptides in myometrium of pregnant women and its impairments under different types of diabetes mellitus
20007901 effect of G6Pd-Mahidol(487A) variant in Southeast Asia on survival in vivax & falciparum malaria; results show positive selection has targeted Mahidol variant over past 1500 years; the variant reduces vivax but not falciparum parasite density
19996424 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19941843 A concomitant response of G6PD activities and RBC fragility towards the oxidative stress was established.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896395 the most frequent mutations of G6PD in diagnosed deficient patients in Panama Children's Hospital
19858149 coexpression of the G6PD African A- mutation with UGT1A1 and/or SLCO1B1 variants was seen more frequently in neonatal hyperbilirubinemia
19858149 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19811411 The decline in the activities of G6PD and b5Rm would indicate a decrease in the antioxidant response associated with RBC aging.
19640310 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
19632868 This is the second documented observation of a class-III variant, we named G6PD Pyrgos, found in a Greek family. A 3-dimensional structure model for the enzyme shows that the region modified by the substitution is identical to that modified in G6PD A(-)
19594365 G6PD Mediterranean S188F codon mutation is common among Saudi sickle cell patients and increases the risk of stroke.
19594365 Observational study of gene-disease association. (HuGE Navigator)
19589177 This study confirmed that G6PD deficiency is strongly associated with haemoglobinuria
19589177 Observational study of gene-disease association. (HuGE Navigator)
19497363 G6PD confers protection against oxidant-induced cytotoxicity through effective glutathione regeneration.
19465117 Results suggest that impaired binding of "structural" NADP(+) can hinder folding as well as cause instability of glucose 6-phosphate dehydrogenase clinical mutant enzymes in the fully folded state.
19422023 A prolonged neonatal jaundice associated with a rare G6PD mutation.
19419973 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19359662 Glucose 6-phosphate dehydrogenase is regulated through c-Src-mediated tyrosine phosphorylation in endothelial cells.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19323016 Both clinical and hematological phenotypes of simple homozygous HbE did not differ from those who also inherited alpha-thalassemia and/or G6PD deficiency.
19317913 Observational study of genotype prevalence. (HuGE Navigator)
19272180 Results show that ectopic expression of hTERT stimulates telomerase activity and prevents accelerated senescence in glucose-6-phosphate dehydrogenase -deficient cells.
19224086 Observational study of genetic testing. (HuGE Navigator)
19223928 G6PD-deficient male hemizygotes and female heterozygotes are protected from severe malaria.
19223928 Observational study of gene-disease association. (HuGE Navigator)
19219640 Our finding indicate the prevalence of factor V Leiden, prothrombin G20210A and MTHFR C677T in G6PD deficiency is not statistically different compared to normal subjects and is not associated with these thrombophilic mutations in Western Iran.
19219640 Observational study of gene-disease association. (HuGE Navigator)
18985093 Nine different glucose-6-phosphate dehydrogenase (G6PD) variants in a Malaysian population with Malay, Chinese, Indian and Orang Asli (aboriginal Malaysian) backgrounds were detected in G6PD-deficient cases.
18677765 glucose-6-phosphate Dehydrogenase exon mutation is associated with hemolytic anemia with Glucose-6-phosphate dehydrogenase deficiency.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18558634 Gene polymorphisms of G6PD were detected in children with hereditary hyperbilirubinemia; degree of genetic heterogeneity and variant coexpression across G6PD gene points to polygenic nature of this disease.
18558634 Observational study of genotype prevalence. (HuGE Navigator)
18494377 Observational study of genotype prevalence. (HuGE Navigator)
18493020 Data show that G6PD thus forms active dimer without structural NADP+. Apparently, the true role of the second, tightly bound NADP+ is to secure long-term stability.
18458302 Observational study of gene-disease association. (HuGE Navigator)
18376107 Observational study of genotype prevalence. (HuGE Navigator)
18302154 G6PD activity was intensely elevated in tumor tissues.
18226470 Screening of 79 Tunisian G6PD deficiency patients revealed a newly described silent mutation in exon 12 associated with the polymorphism in the intron 11 93 TC in one subject and 2 single intronic base deletions: IVS V 17 (-C) & IVS VIII 43 (-G).
18215251 Observational study of gene-disease association. (HuGE Navigator)
18173836 Observational study of gene-disease association. (HuGE Navigator)
18164966 Whereas the frequency of beta-thalassemia minor among Moslems is higher than in the Jews in Shiraz, the frequency of G6PD deficiency was not significantly different in the two populations.
18164966 Observational study of genotype prevalence. (HuGE Navigator)
18086567 A symptomatic baby is affected by severe deficiency of glucose 6-phosphate dehydrogenase activity due to a novel de novo genetic mutation that may have occurred in a very early stage of embryogenesis or in the mother's germ cell lines.
18066402 Three novel mutations in the G6PD gene are presented, andt the changes they cause in the 3-dimensional structure of the enzyme are discussed.
18056001 investigation of mutations and G6PD locus haplotype diversity in Portuguese G6PD-deficient individuals
18046504 glucose-6-phosphate dehydrogenase mutations in Mon and Burmese males of southern Myanmar who migrated to Thailand in Samutsakhon province. G
18043863 Mutation in the glucose-6-phosphate dehydrogenase gene is associated with Glucose-6-phosphate dehydrogenase deficiency
17959407 Purification and detailed study of two clinically different human glucose 6-phosphate dehydrogenase variants, G6PD(Plymouth) and G6PD(Mahidol).
17877203 Glucose-6-phosphate dehydrogenase G1376T and G1388A are the most common mutations in the populations of the Han and Li nationalities in Hainan.
17660836 In hematopoietic stem cell transplantationfemale donors heterozygous for X-linked recessive disorders, altered G6PD may cause clinical diseases in the recipients.
17653668 prevalence of glucose-6-phosphate dehydrogenase (G6PD) deficiency and its gene mutations were studied in the Achang population of Southwestern China; a new polymorphism IVS5-612 (G>C), which combined into a novel haplotype, was identified
17637841 G6PD variants have been compared with mutants from germany and other countries.
17611006 biochemical and clinical effect of variants and discussion of the relationship between genotype and phenotype [review]
17587269 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17587269 study found that the nucleotide substitutions associated with G6PD deficiency in Chinese subjects are distinctly different from those associated with G6PD deficiency in other ethnic groups
17557555 Observational study of gene-disease association. (HuGE Navigator)
17557555 results do not confirm an association either positive or negative between the G6PD polymorphism and lymphoma risk.
17524386 A novel genetic mutation (G130A) in the third exon was found in a case of an asymptomatic young subject affected by severe deficiency of Glucose 6-phosphate dehydrogenase (G6PD) activity.
17499234 Observational study of genotype prevalence. (HuGE Navigator)
17499234 Three different major polymorphic variants were found in Iran: G6PD Mediterranean 75.4% (187 out of 248), G6PD Chatham 19.76% (49 out of 248), G6PD Cosenza 2.02% (5 out of 248) and 7 samples out of 248 remained unknown.
17264545 Observational study of genotype prevalence. (HuGE Navigator)
17077204 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17018380 Observational study of genotype prevalence. (HuGE Navigator)
17007653 Observational study of genotype prevalence. (HuGE Navigator)
16944148 Novel missense mutation in glucose-6-phosphate dehydrogenase gene causing chronic nonspherocytic hemolytic anemia.
16934959 These results, together with structural information, suggest that the instability of the R393H protein, enhanced by the weakened binding of "structural" NADP+, is the likely cause of the severe clinical manifestation observed for G6PD(Nashville).
16927025 analysis of glucose-6-phosphate dehydrogenase variants in Flores Island, eastern Indonesia
16859949 Observational study of gene-disease association. (HuGE Navigator)
16792831 Observational study of genotype prevalence. (HuGE Navigator)
16637741 Observational study of gene-disease association. (HuGE Navigator)
16607506 Arg459 and Arg463 play important roles in anchoring NADP+ to the catalytic domain, sequence from codon 459 to the carboxyl terminal is essential for the enzymatic function.
16569302 Observational study of genotype prevalence. (HuGE Navigator)
16532971 Observational study of genotype prevalence. (HuGE Navigator)
16483869 Microtubule motor proteins colocalize with G6PDase; microtubule motor proteins participate in hexose monophosphate shunt enzyme transport within leukocytes.
16461316 Observational study of genotype prevalence. (HuGE Navigator)
16356170 Observational study of genetic testing. (HuGE Navigator)
16331553 Data show that 34 heterozygous females with from patients with G6PD deficiency variants was identified by denaturing high-performance liquid chromatography.
16331553 Observational study of genetic testing. (HuGE Navigator)
16272653 Observational study of genotype prevalence. (HuGE Navigator)
16255851 G-6-PD deficiency coexists with G71R or A388G mutation in some individuals with neonatal jaundice in Guangxi region.
16255851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16155737 Observational study of genotype prevalence. (HuGE Navigator)
16155737 G6PD Viangchan (871G>A) is the most common G6PD-deficient variant in the Cambodian population.
16143877 A novel variant, named G6PD Split, is caused by a nucleotide change 1442 C-->G leading to the amino acid substitution 481 Pro-->Arg and is characterized by moderate enzyme deficiency (class III variant).
16137669 Observational study of genetic testing. (HuGE Navigator)
16136268 Observational study of genotype prevalence. (HuGE Navigator)
16088936 analysis of disease phenotype in two human glucose 6-phosphate dehydrogenase mutants, G6PD(Union) and G6PD(Andalus)
16059744 Observational study of gene-disease association. (HuGE Navigator)
15957246 Mediterranean mutation at nt 563(C-->T) is predominant in the Iran's Golestan province (69%) and 26.7% of patients have Chatham mutation at nt 1003(G-->A)
15914531 Observational study of gene-disease association. (HuGE Navigator)
15914531 G6PD deficiency alone is not causative of diabetic ketosis and alterations in genes controlling both insulin secretion and G6PD-mediated antioxidant defenses may contribute to the predisposition in West Africans
15906719 Observational study of genetic testing. (HuGE Navigator)
15906717 G6PD Viangchan and G6PD Mediterranean account for the main variants in G6PD deficiency among the Malay population in Malaysia.
15864125 UGT1A1, OATP2 and G6PD genes have roles in genetic predisposition to unconjugated hyperbilirubinemia
15766741 Observational study of genetic testing. (HuGE Navigator)
15748456 Observational study of genotype prevalence. (HuGE Navigator)
15727905 Observational study of genotype prevalence. (HuGE Navigator)
15727905 G6PD Viangchan and Mahidol are common Southeast Asian variants and support the theory of genetic drifts throughout Southeast Asia.
15718915 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15659240 We have shown two distinct CREB-responsive sites in the glucose-6-phosphatase gene promoter that are responding to a constitutively active CREB or elevated concentrations of the catalytic subunit of cAMP-dependent protein kinase in the nucleus.
15622766 G6PD mutation from G6PD deficient patients were analyzed.
15598086 Based on the increased susceptibility of G6PD-deficient patients to oxidative stress, an increase in Se-GSH-Px activity can facilitate the detoxification of reactive oxygen species.
15558953 Observational study of gene-environment interaction, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
15506519 Review. Nearly 150 different G6PD variants have been described. The recent determination of its 3-dimensional structure explains the mechanisms of G6PD deficiency in terms of structure-function relationship.
15476167 G6PD cDNA 1388 (G-->A), 1376 (G-->T), 95(A--> G), 392 (G-->T), 1024 (C-->T) and 1311 (C-->T) accompanied with intron 11 (93 T-->C) are the common mutations in Chinese population.
15466166 uncommon splice site mutation causes enzyme deficiency
15330559 Observational study of genotype prevalence. (HuGE Navigator)
15315792 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15315792 genetic diversity of enzyme forms in GPD deficiency in India.
15307413 Observational study of gene-disease association. (HuGE Navigator)
15282679 Observational study of genetic testing. (HuGE Navigator)
15223006 determined the frequency of glucose-6-phosphate dehydrogenase (G6PD) deficiency in Cyprus; one previously undescribed mutation in exon 3, 148C-->T (Pro50Ser), was found
14757426 gene 1226 C-->G mutation in a chronic nonspherocytic hemolytic anemia patient causes significant differences in Km values and enzyme stability, by changing tetramer interactions and disturbing the binding of structural NADP+
14757424 identified two de novo missense mutations in patients with severe G6PD deficiency as sites Pro409 and Val431, located on different subunits, that interact directly across the subunit interface and perturb formation of the G6PD dimer upon mutation
14614139 distribution of erythrocyte G6PD activity in human populations reveals a selective pressure for maintaining high activity
12972027 Observational study of genotype prevalence. (HuGE Navigator)
12972027 4% of males in the Kuwaiti population have G6PD deficiency coexisting with low activity of the UDPGT1 promoter
12921788 glycolaldehyde inactivates glucose-6-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, and Cu,Zn superoxide dismutase, suppresses cell growth, and induces apoptosis.
12850494 screening a Mexican population identified new mutations located at cDNA nt 376 A --> T (126 Asn --> Tyr), nt 770 G --> T (257 Arg --> Leu), nt 1094 G --> A (365 Arg --> His), and nt 1285 A --> G (429 Lys --> Glu)
12768444 G6PD deficiency was studied in Nepalese males.
12737943 This study suggests that the metabolic consequences of a combined deficiency of GPI and G6PD might be responsible for a different clinical outcome, severe congenital hemolytic anemia, than predicted for either defect in isolation.
12737940 Molecular characterization of G6PD Insuli--a novel 989 CGC --> CAC (330 Arg --> His) mutation in exon 9 in the Indian population with normal enzyme activity
12737938 the association of G6PD Sumare and G6PD A- in a compound heterozygote gave rise to a very mild chronic hemolysis, and the red cell population containing G6PD A- is probably enough to protect against severe chronic hemolysis
12696079 Observational study of gene-disease association. (HuGE Navigator)
12680285 Observational study of gene-disease association. (HuGE Navigator)
12641410 Observational study of gene-disease association. (HuGE Navigator)
12616531 HPRT and G6PD origins of replication that are functional in the active X chromosome are utilized even when the two genes are transcriptionally silent in the inactive X chromosome.
12588050 Significant difference in distribution of G6PD activities as grouped by an increment of 100 U/10(12) red blood cells (RBCs) was observed between diabetic patients and healthy subjects.
12524354 Nucleotide variability at G6pd and the signature of malarial selection in humans.
12497642 Observational study of genotype prevalence. (HuGE Navigator)
12497642 Mutational analysis of G6PD variants in Malaysian Malays with G6PD deficiency.
12439228 Observational study of gene-gene interaction. (HuGE Navigator)
12380870 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
12378426 nucleotide diversity across a 5.2-kb region of G6PD in a sample of 160 Africans and 56 non-Africans, to determine how selection has shaped patterns of DNA variation at this gene
12135480 Recombinant human glucose-6-phosphate dehydrogenase uses a rapid-equilibrium random-order mechanism for substrate binding.
12130518 Deletion of leucine 61 in glucose-6-phosphate dehydrogenase leads to chronic nonspherocytic anemia, granulocyte dysfunction, and increased susceptibility to infections.
11920200 31 alleles carrying the betaS mutation, 6 beta-thalassaemic alleles & 17 G6PD alleles, were studied from a group of carriers or affected subjects. Allele frequencies were 3% for haemoglobin S, 1% for beta-thalassaemia trait and 9.5% for G6PD deficiency.
11877026 Observational study of genotype prevalence. (HuGE Navigator)
11876979 Observational study of genotype prevalence. (HuGE Navigator)
11874436 a candidate gene for diabetes
11852882 A single mutation 202G>A in the human glucose-6-phosphate dehydrogenase gene (G6PD) can cause acute hemolysis by itself.
11793482 Observational study of genotype prevalence. (HuGE Navigator)
11793482 DNA mutational analysis in Thailand: G6PD Viangchan (871G>A) is the most common deficiency variant in the Thai population
11499668 Observational study of genotype prevalence. (HuGE Navigator)
11042039 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11024211 Observational study of genotype prevalence. (HuGE Navigator)
8356804 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of glucose-6-phosphate dehydrogenase (G6PD) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MAEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGY      1 - 70
ARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYL     71 - 140
ALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLGKEMVQN    141 - 210
LMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTN    211 - 280
SDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWD    281 - 350
GVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL    351 - 420
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPT    421 - 490
EADELMKRVGFQYEGTYKWVNPHKL                                                 491 - 515
//

Text Mined References (302)

PMID Year Title
27097228 2016 Diminished COX-2/PGE2-Mediated Antiviral Response Due to Impaired NOX/MAPK Signaling in G6PD-Knockdown Lung Epithelial Cells.
26976705 2016 G6PD protects from oxidative damage and improves healthspan in mice.
26840990 2016 Glucose-6-Phosphate Dehydrogenase Deficiency in Brazilian Children With Sickle Cell Anemia is not Associated With Clinical Ischemic Stroke or High-Risk Transcranial Doppler.
26829728 2016 [Molecular epidemiology of G6PD deficiency in Chaozhou area of eastern Guangdong Province].
26823837 2015 Molecular epidemiological investigation of G6PD deficiency by a gene chip among Chinese Hakka of southern Jiangxi province.
26694452 2015 Glucose-6-Phosphate Dehydrogenase Enhances Antiviral Response through Downregulation of NADPH Sensor HSCARG and Upregulation of NF-?B Signaling.
26621836 2016 BAG3 elevation inhibits cell proliferation via direct interaction with G6PD in hepatocellular carcinomas.
26607846 2015 Overexpression of G6PD is associated with high risks of recurrent metastasis and poor progression-free survival in primary breast carcinoma.
26479991 2015 Severe G6PD Deficiency Due to a New Missense Mutation in an Infant of Northern European Descent.
26399441 2015 O-GlcNAcylation of G6PD promotes the pentose phosphate pathway and tumor growth.
26139767 2015 Glucose-6-phosphate dehydrogenase (G6PD) deficiency among tribal populations of India - Country scenario.
26004559 2015 Glucose-6-phosphate dehydrogenase deficiency and Alzheimer's disease: Partners in crime? The hypothesis.
25979194 Protein-protein interaction network analysis and identifying regulation microRNAs in asthmatic children.
25885177 2015 G6PD gene variants and its association with malaria in a Sri Lankan population.
25818003 2015 Identification of proteins responsible for adriamycin resistance in breast cancer cells using proteomics analysis.
25671784 2015 African glucose-6-phosphate dehydrogenase alleles associated with protection from severe malaria in heterozygous females in Tanzania.
25633909 2015 iTRAQ-based quantitative proteomic analysis of cervical cancer.
25616277 2015 Elevated glucose-6-phosphate dehydrogenase expression in the cervical cancer cases is associated with the cancerigenic event of high-risk human papillomaviruses.
25536053 2014 Characterization of G6PD genotypes and phenotypes on the northwestern Thailand-Myanmar border.
25416956 2014 A proteome-scale map of the human interactome network.
25407525 2014 The stability of G6PD is affected by mutations with different clinical phenotypes.
25297600 2014 [Molecular epidemiology analysis of glucose-6-phosphate dehydrogenase gene mutations among infertile patients in Shenzhen].
25261933 2014 Reappraisal of known malaria resistance loci in a large multicenter study.
25261071 2014 Adequate hemodialysis improves anemia by enhancing glucose-6-phosphate dehydrogenase activity in patients with end-stage renal disease.
25246627 2014 Early neonatal bilirubin, hematocrit, and glucose-6-phosphate dehydrogenase status.
25201310 2014 Genetic determinants of glucose-6-phosphate dehydrogenase activity in Kenya.
25189226 2014 Glucose-6-phosphate dehydrogenase deficiency in northern Mexico and description of a novel mutation.
25169987 2014 Prevalence of glucose-6-phosphate dehydrogenase deficiency and the role of the A- variant in a Saudi population.
25015414 2014 Glucose-6-phosphate dehydrogenase polymorphisms and susceptibility to mild malaria in Dogon and Fulani, Mali.
24994855 2014 Changes in glucose-6-phosphate dehydrogenase expression results in altered behavior of HBV-associated liver cancer cells.
24958328 2014 DNA hypermethylation and X chromosome inactivation are major determinants of phenotypic variation in women heterozygous for G6PD mutations.
24853873 2014 First evaluation of glucose-6-phosphate dehydrogenase (G6PD) deficiency in vivax malaria endemic regions in the Republic of Korea.
24805191 2014 Transcriptional and epigenetic basis for restoration of G6PD enzymatic activity in human G6PD-deficient cells.
24769394 2014 Regulation of G6PD acetylation by SIRT2 and KAT9 modulates NADPH homeostasis and cell survival during oxidative stress.
24636884 2014 Increased basal oxidation of peroxiredoxin 2 and limited peroxiredoxin recycling in glucose-6-phosphate dehydrogenase-deficient erythrocytes from newborn infants.
24615128 2014 G6PD A- deficiency and severe malaria in The Gambia: heterozygote advantage and possible homozygote disadvantage.
24586352 2014 A population survey of the glucose-6-phosphate dehydrogenase (G6PD) 563C>T (Mediterranean) mutation in Afghanistan.
24460025 2014 Glucose-6-Phosphate Dehydrogenase (G6PD) deficiency in Greek newborns: the Mediterranean C563T mutation screening.
24270845 2013 A critical role of glucose-6-phosphate dehydrogenase in TAp73-mediated cell proliferation.
24223971 2013 Glucose-6-phosphate dehydrogenase (G6PD)-deficient epithelial cells are less tolerant to infection by Staphylococcus aureus.
24146346 2013 Cloning, expression, purification and characterization of his-tagged human glucose-6-phosphate dehydrogenase: a simplified method for protein yield.
24134566 2014 Glucose-6-phosphate dehydrogenase deficiency in Italian blood donors: prevalence and molecular defect characterization.
23742107 2013 Proteome-wide dysregulation by glucose-6-phosphate dehydrogenase (G6PD) reveals a novel protective role for G6PD in aflatoxin B?-mediated cytotoxicity.
23696099 2013 Genetic variants that confer resistance to malaria are associated with red blood cell traits in African-Americans: an electronic medical record-based genome-wide association study.
23693134 2013 Variant G6PD levels promote tumor cell proliferation or apoptosis via the STAT3/5 pathway in the human melanoma xenograft mouse model.
23640907 2013 Risk factors associated with unconjugated neonatal hyperbilirubinemia in Malaysian neonates.
23631859 2013 Starvation actively inhibits splicing of glucose-6-phosphate dehydrogenase mRNA via a bifunctional ESE/ESS element bound by hnRNP K.
23569738 2011 Glucose-6-phosphate-dehydrogenase deficiency and its correlation with other risk factors in jaundiced newborns in Southern Brazil.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23485169 2013 Do matrix metalloproteinase-1 and glucose-6-phosphate dehydrogenase gene polymorphisms interact in promoting lymphoma development?
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23389243 2013 3'-UTR variations and G6PD deficiency.
23275194 2013 Glucose-6-phosphate dehydrogenase (G6PD) gene mutations detection by improved high-resolution DNA melting assay.
23233666 2013 Serine arginine splicing factor 3 is involved in enhanced splicing of glucose-6-phosphate dehydrogenase RNA in response to nutrients and hormones in liver.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185302 2012 Increasing glucose 6-phosphate dehydrogenase activity restores redox balance in vascular endothelial cells exposed to high glucose.
23146719 2013 Analysis of the genetic variants of glucose-6-phosphate dehydrogenase in inhabitants of the 4th Nile cataract region in Sudan.
23144702 2012 Candidate human genetic polymorphisms and severe malaria in a Tanzanian population.
23065279 2013 Glucose-6-phosphate dehydrogenase deficiency in Tunisia: molecular data and phenotype-genotype association.
23023104 2013 Identification and characterization of novel human glucose-6-phosphate dehydrogenase inhibitors.
22963789 2013 Two new class III G6PD variants [G6PD Tunis (c.920A>C: p.307Gln>Pro) and G6PD Nefza (c.968T>C: p.323 Leu>Pro)] and overview of the spectrum of mutations in Tunisia.
22958163 2012 Magnetic resonance angiography-defined intracranial vasculopathy is associated with silent cerebral infarcts and glucose-6-phosphate dehydrogenase mutation in children with sickle cell anaemia.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22906837 2012 Molecular characterization of glucose-6-phosphate dehydrogenase deficiency among Jordanians.
22906047 2012 Neonatal hyperbilirubinemia in infants with G6PD c.563C > T Variant.
22848499 2012 Integrative gene expression profiling reveals G6PD-mediated resistance to RNA-directed nucleoside analogues in B-cell neoplasms.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22770933 2012 Molecular heterogeneity of glucose-6-phosphate dehydrogenase deficiency in Gaza Strip Palestinians.
22768742 [Erythrocytic enzymopathy in Uzbekistan].
22552160 2013 Three new mutations account for the prevalence of glucose 6 phosphate deshydrogenase (G6PD) deficiency in Tunisia.
22537951 2012 [Genetic factors in the occurrence of neonatal unconjugated hyperbilirubinemia].
22431005 2012 Glucose-6-phosphate dehydrogenase, NADPH, and cell survival.
22364808 2012 Hemolysis and Mediterranean G6PD mutation (c.563 C>T) and c.1311 C>T polymorphism among Palestinians at Gaza Strip.
22307442 A novel GLA mutation in a Fabry family with glucose-6-phosphate dehydrogenase deficiency.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22165289 2011 Enzyme kinetics and molecular modeling studies of G6PD(Mahidol) associated with acute hemolytic anemia.
22139979 2012 Practical approach for characterization of glucose 6-phosphate dehydrogenase (G6PD) deficiency in countries with population ethnically heterogeneous: description of seven new G6PD mutants.
22117603 2012 Association of homozygous sickle cell anemia and glucose-6-phosphate dehydrogenase deficiency.
22012600 2012 Overexpression of G6PD is associated with poor clinical outcome in gastric cancer.
21549219 2011 G6PD A-variant influences the antibody responses to Plasmodium falciparum MSP2.
21507207 2011 Molecular characterization of glucose-6-phosphate dehydrogenase deficiency in Pakistani population.
21507164 2011 Prevalence and molecular study of G6PD deficiency in Malaysian Orang Asli.
21397531 2011 Chronic hemolytic anemia is associated with a new glucose-6-phosphate dehydrogenase in-frame deletion in an older woman.
21376267 2011 Glucose-6-phosphate-dehydrogenase deficiency may impart susceptibility to the development of AIDS.
21376116 2011 Stress response and cytoskeletal proteins involved in erythrocyte membrane remodeling upon Plasmodium falciparum invasion are differentially carbonylated in G6PD A- deficiency.
21302115 2011 Chronic nonspherocytic hemolytic anemia due to glucose-6-phosphate dehydrogenase deficiency: report of two families with novel mutations causing G6PD Bangkok and G6PD Bangkok Noi.
21269460 2011 Initial characterization of the human central proteome.
21205543 2010 Mediterranean glucose-6-phosphate dehydrogenase (G6PD(C563T)) mutation among Jordanian females with acute hemolytic crisis.
21180140 2007 [Effect of glucose-6-phosphate dehydrogenase on intracellular gsh level in Raji cells during oxidative stress].
21157431 2011 ATM activates the pentose phosphate pathway promoting anti-oxidant defence and DNA repair.
21125776 2010 Birth control necessary to limit family size in tribal couples with aberrant heterosis of G-6-PD deficiency and sickle cell disorders in India: an urgency of creating awareness and imparting genetic counseling.
20949590 2011 Cooperating G6PD mutations associated with severe neonatal hyperbilirubinemia and cholestasis.
20927393 2010 Relating mutant genotype to phenotype via quantitative behavior of the NADPH redox cycle in human erythrocytes.
20713184 2010 A large, systematic molecular-genetic study of G6PD in Indian populations identifies a new non-synonymous variant and supports recent positive selection.
20684792 2010 Population screening for glucose-6-phosphate dehydrogenase deficiencies in Isabel Province, Solomon Islands, using a modified enzyme assay on filter paper dried bloodspots.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20621077 2010 G6PD Murcia, G6PD Ube and G6PD Orissa: report of three G6PD mutations unusual for Italian population.
20602793 2010 Prevalence and molecular characterization of Glucose-6-Phosphate dehydrogenase deficient variants among the Kurdish population of Northern Iraq.
20582980 2010 A novel G473A mutation in the glucose-6-phosphate dehydrogenase gene.
20528626 2011 Restriction fragment length polymorphism (RFLP) of the X chromosome linked glucose-6-phosphate dehydrogenase (G6PD) locus in India.
20520804 2010 The impact of phenotypic and genotypic G6PD deficiency on risk of plasmodium vivax infection: a case-control study amongst Afghan refugees in Pakistan.
20514852 2009 Variants of organic anion transporter polypeptide 2 gene are not risk factors associated with severe neonatal hyperbilirubinemia.
20507315 2010 Association of G6PD with lower haemoglobin concentration but not increased haemolysis in patients with sickle cell anaemia.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
20447239 2010 Frequency of Mediterranean mutation among a group of Saudi G6PD patients in Western region-Jeddah.
20236109 2010 Genetics of glucose-6-phosphate dehydrogenase deficiency in Saudi patients.
20203002 2010 Rapid and reliable detection of glucose-6-phosphate dehydrogenase (G6PD) gene mutations in Han Chinese using high-resolution melting analysis.
20200584 2010 The first case of a class I glucose-6-phosphate dehydrogenase deficiency, G6PD Santiago de Cuba (1339 G > A), in a Chinese population as found in a survey for G6PD deficiency in northeastern and central China.
20118060 2009 Predictors of severe hemolysis in patients with glucose-6-phosphate dehydrogenase deficiency following exposure to oxidant stresses.
20113600 2009 [Relationship between glucose-6-phosphate dehydrogenase gene mutations and neonatal jaundice in Naning, Guangxi].
20032314 2010 High glucose inhibits glucose-6-phosphate dehydrogenase, leading to increased oxidative stress and beta-cell apoptosis.
20017397 [The regulation of glucose-6-phosphate dehydrogenase and glycogen synthase activities by insulin superfamily peptides in myometrium of pregnant women and its impairments under different types of diabetes mellitus].
20007901 2009 Positively selected G6PD-Mahidol mutation reduces Plasmodium vivax density in Southeast Asians.
19996424 2009 Chlorproguanil-dapsone-artesunate versus chlorproguanil-dapsone: a randomized, double-blind, phase III trial in African children, adolescents, and adults with uncomplicated Plasmodium falciparum malaria.
19946888 2010 Defining the membrane proteome of NK cells.
19941843 2010 Synchrony of G6PD activity and RBC fragility under oxidative stress exerted at normal and G6PD deficiency.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896395 Glucose-6-phosphate dehydrogenase (G6PD) molecular variant deficiency: identification in Panama pediatric population.
19858149 2009 Complex multifactorial nature of significant hyperbilirubinemia in neonates.
19811411 2009 Effects of aging on antioxidant response and phagocytosis in senescent erythrocytes.
19640310 2009 Population study of 1311 C/T polymorphism of Glucose 6 Phosphate Dehydrogenase gene in Pakistan - an analysis of 715 X-chromosomes.
19632868 A rare G6PD variant (c.383T>G; p.128Leu>Arg) with a molecular pathophysiological mechanism similar to that of G6PD A- (68Val>Met, 126Asn>Asp).
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19594365 2009 G6PD Mediterranean S188F codon mutation is common among Saudi sickle cell patients and increases the risk of stroke.
19589177 2009 Glucose-6-phosphate dehydrogenase (G6PD) mutations and haemoglobinuria syndrome in the Vietnamese population.
19497363 2009 Ineffective GSH regeneration enhances G6PD-knockdown Hep G2 cell sensitivity to diamide-induced oxidative damage.
19465117 2009 Clinical mutants of human glucose 6-phosphate dehydrogenase: impairment of NADP(+) binding affects both folding and stability.
19422023 2009 A prolonged neonatal jaundice associated with a rare G6PD mutation.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19359662 2009 Glucose 6-phosphate dehydrogenase is regulated through c-Src-mediated tyrosine phosphorylation in endothelial cells.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19323016 2009 Clinical and hematological phenotype of homozygous hemoglobin E: revisit of a benign condition with hidden reproductive risk.
19317913 2009 Toll-like receptor polymorphisms in malaria-endemic populations.
19272180 2009 Telomerase prevents accelerated senescence in glucose-6-phosphate dehydrogenase (G6PD)-deficient human fibroblasts.
19224086 2009 Comparison of detection of glucose-6-phosphate dehydrogenase deficiency using fluorescent spot test, enzyme assay and molecular method for prediction of severe neonatal hyperbilirubinaemia.
19223928 2009 Allelic heterogeneity of G6PD deficiency in West Africa and severe malaria susceptibility.
19219640 2009 The prevalence of factor V Leiden, prothrombin G20210A and methylenetetrahydrofolate reductase polymorphism C677T among G6PD deficient individuals from Western Iran.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18985093 2008 Nine different glucose-6-phosphate dehydrogenase (G6PD) variants in a Malaysian population with Malay, Chinese, Indian and Orang Asli (aboriginal Malaysian) backgrounds.
18677765 2008 A novel G6PD mutation leading to chronic hemolytic anemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18558634 2008 Coexpression of gene polymorphisms involved in bilirubin production and metabolism.
18494377 2007 G6PD deficient alleles and haplotype analysis of human G6PD locus in São Tomé e Príncipe (West Africa).
18493020 2008 What is the role of the second "structural" NADP+-binding site in human glucose 6-phosphate dehydrogenase?
18458302 2008 Reduced risk of uncomplicated malaria episodes in children with alpha+-thalassemia in northeastern Tanzania.
18376107 2008 Thalassaemia and glucose-6-phosphate dehydrogenase screening in 13- to 14-year-old students of the Sardinian population: preliminary findings.
18302154 2008 Metastasis is promoted by a bioenergetic switch: new targets for progressive renal cell cancer.
18226470 2008 Molecular characterization of erythrocyte glucose-6-phosphate dehydrogenase deficiency in Tunisia.
18215251 2008 Multiplicity of Plasmodium falciparum infection in asymptomatic children in Senegal: relation to transmission, age and erythrocyte variants.
18173836 2008 Host erythrocyte polymorphisms and exposure to Plasmodium falciparum in Papua New Guinea.
18164966 2008 Prevalence of beta-thalassemia trait and glucose-6-phosphate dehydrogenase deficiency in Iranian Jews.
18086567 2008 Glucose-6-phosphate dehydrogenase Buenos Aires: a novel de novo missense mutation associated with severe enzyme deficiency.
18066402 2007 Molecular analysis of three novel G6PD variants: G6PD Pedoplis-Ckaro, G6PD Piotrkow and G6PD Krakow.
18056001 2007 Mutations and haplotype diversity in 70 Portuguese G6PD-deficient individuals: an overview on the origin and evolution of mutated alleles.
18046504 2008 Glucose-6-phosphate dehydrogenase mutations in Mon and Burmese of southern Myanmar.
18043863 2008 A novel R198H mutation in the glucose-6-phosphate dehydrogenase gene in the tribal groups of the Nilgiris in Southern India.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17959407 2008 Purification and detailed study of two clinically different human glucose 6-phosphate dehydrogenase variants, G6PD(Plymouth) and G6PD(Mahidol): Evidence for defective protein folding as the basis of disease.
17877203 2007 [Molecular characterization of 71 cases of glucose-6-phosphate dehydrogenase deficiency in Hainan province].
17660836 2007 G6PD deficiency from lyonization after hematopoietic stem cell transplantation from female heterozygous donors.
17653668 2007 Characterization of glucose-6-phosphate dehydrogenase deficiency and identification of a novel haplotype 487G>A/IVS5-612(G>C) in the Achang population of Southwestern China.
17637841 2007 Three-dimensional modeling of glucose-6-phosphate dehydrogenase-deficient variants from German ancestry.
17611006 2007 G6PD deficiency: the genotype-phenotype association.
17587269 2007 Three mutations analysis of glucose-6-phosphate dehydrogenase deficiency in neonates in South-west China.
17557555 Glucose-6-phosphate dehydrogenase polymorphism and lymphoma risk.
17524386 2007 Description of a novel missense mutation of glucose-6-phosphate dehydrogenase gene associated with asymptomatic high enzyme deficiency.
17516514 2008 Mutation in G6PD gene leads to loss of cellular control of protein glutathionylation: mechanism and implication.
17499234 2007 A comprehensive study on the major mutations in glucose-6-phosphate dehydrogenase-deficient polymorphic variants identified in the coastal provinces of Caspian Sea in the north of Iran.
17361089 2007 Production of inflammatory molecules in peripheral blood mononuclear cells from severely glucose-6-phosphate dehydrogenase-deficient subjects.
17264545 G6PD deficiency, distribution and variants in Saudi Arabia: an overview.
17077204 2006 Glucose-6-phosphate dehydrogenase deficiency in female octogenarians, nanogenarians, and centenarians.
17018380 2006 Incidence and complete molecular characterization of glucose-6-phosphate dehydrogenase deficiency in the Guangxi Zhuang autonomous region of southern China: description of four novel mutations.
17007653 2006 Red blood cell disorders in Rwandese neonates: screening for sickle cell disease and glucose-6-phosphate dehydrogenase deficiency.
16944148 2006 A novel missense mutation in glucose-6-phosphate dehydrogenase gene causing chronic nonspherocytic hemolytic anemia in an Indian family.
16934959 2006 Functional properties of two mutants of human glucose 6-phosphate dehydrogenase, R393G and R393H, corresponding to the clinical variants G6PD Wisconsin and Nashville.
16927025 2006 Further investigations of glucose-6-phosphate dehydrogenase variants in Flores Island, eastern Indonesia.
16859949 2006 Red blood cell polymorphisms in relation to Plasmodium falciparum asymptomatic parasite densities and morbidity in Senegal.
16792831 2006 Prevalence of G6PD deficiency in newborns in the south of Brazil.
16637741 2006 Seasonal childhood anaemia in West Africa is associated with the haptoglobin 2-2 genotype.
16607506 2006 Structure and function of glucose-6-phosphate dehydrogenase-deficient variants in Chinese population.
16569302 2006 Prevalence of G6PD deficiency and knowledge of diagnosis in a sample of previously unscreened Lebanese males: clinical implications.
16532971 2005 [Glucose-6-phosphate dehydrogenase gene mutations in She nationality, Fujian province].
16483869 2006 Apparent role of dynein in glucose-6-phosphate dehydrogenase trafficking in neutrophils from pregnant women.
16461316 2006 The role of the G6PD AEth376G/968C allele in glucose-6-phosphate dehydrogenase deficiency in the seerer population of Senegal.
16356170 2005 Rapid screening for glucose-6-phosphate dehydrogenase deficiency and haemoglobin polymorphisms in Africa by a simple high-throughput SSOP-ELISA method.
16331553 2005 Denaturing high-performance liquid chromatography technique platform applied to screen G6PD deficient variants.
16272653 2005 Neonatal screening for glucose-6-phosphate dehydrogenase deficiency.
16255851 2005 [Role of genetic factors in occurrence of neonatal jaundice in Guangxi region].
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16155737 2005 G6PD Viangchan (871G>A) is the most common G6PD-deficient variant in the Cambodian population.
16143877 2005 Characterization of G6PD deficiency in southern Croatia: description of a new variant, G6PD Split.
16137669 2005 Rapid detection of glucose-6-phosphate dehydrogenase gene mutations by denaturing high-performance liquid chromatography.
16136268 2005 Glucose-6-phosphate dehydrogenase (G6PD) mutations in Cambodia: G6PD Viangchan (871G>A) is the most common variant in the Cambodian population.
16088936 2005 Marked decrease in specific activity contributes to disease phenotype in two human glucose 6-phosphate dehydrogenase mutants, G6PD(Union) and G6PD(Andalus).
16059744 2005 Glucose-6-phosphate dehydrogenase deficiency and Southeast Asian ovalocytosis in asymptomatic Plasmodium carriers in Sumba island, Indonesia.
16020776 2005 The extent of linkage disequilibrium caused by selection on G6PD in humans.
15957246 2004 Molecular identification of mutations in G6PD gene in patients with favism in Iran.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15914531 2005 High prevalence of glucose-6-phosphate dehydrogenase deficiency without gene mutation suggests a novel genetic mechanism predisposing to ketosis-prone diabetes.
15906719 2003 Using the fluorescence spot test for neonatal screening of G6PD deficiency.
15906717 2003 G6PD Viangchan and G6PD Mediterranean are the main variants in G6PD deficiency in the Malay population of Malaysia.
15864125 2005 Genetic factors related to unconjugated hyperbilirubinemia amongst adults.
15858258 2005 Structural studies of glucose-6-phosphate and NADP+ binding to human glucose-6-phosphate dehydrogenase.
15772651 2005 The DNA sequence of the human X chromosome.
15766741 2005 Detection of three common G6PD gene mutations in Chinese individuals by probe melting curves.
15748456 2005 [G6PD Gene Mutations in Shui people in Sandu of Guizhou].
15727905 Molecular heterogeneity of glucose-6-phosphate dehydrogenase (G6PD) variants in the south of Thailand and identification of a novel variant (G6PD Songklanagarind).
15718915 2005 Dominance of high-producing interleukin 6 and low-producing interleukin 10 and interferon gamma alleles in glucose-6-phosphate dehydrogenase-deficient trauma patients.
15659240 2005 cAMP response element binding protein (CREB) activates transcription via two distinct genetic elements of the human glucose-6-phosphatase gene.
15622766 1997 [Identification of G6PD gene mutations in several nationalities from Yunnan province].
15598086 2004 N-acetyl cysteine, L-cysteine, and beta-mercaptoethanol augment selenium-glutathione peroxidase activity in glucose-6-phosphate dehydrogenase-deficient human erythrocytes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15558953 2004 Investigation of the mutation points and effects of some drugs on glucose-6-phosphate dehydrogenase-deficient people in the Erzurum region.
15506519 2004 [Glucose 6-phosphate dehydrogenase deficiency: a protection against malaria and a risk for hemolytic accidents].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476167 2004 [Identification of G6PD gene variants from Hakka population in Guangdong province].
15466166 2004 Glucose-6-phosphate dehydrogenase (G6PD) deficiency-type Zurich: a splice site mutation as an uncommon mechanism producing enzyme deficiency.
15330559 2002 Red cell glucose-6-phosphate dehydrogenase phenotypes in Iraq.
15315792 Molecular basis of G6PD deficiency in India.
15307413 Frequencies of sickle cell trait and glucose-6-phosphate dehydrogenase deficiency differ in highland and nearby lowland malaria-endemic areas of Kenya.
15282679 2004 Rapid detection of common Chinese glucose-6-phosphate dehydrogenase (G6PD) mutations by microarray-based assay.
15223006 Molecular characterization of G6PD deficiency in Cyprus.
14757426 A novel mutation in the glucose-6-phosphate dehydrogenase gene in a subject with chronic nonspherocytic hemolytic anemia--characterization of enzyme using yeast expression system and molecular modeling.
14757424 Distinct phenotypic expression of two de novo missense mutations affecting the dimer interface of glucose-6-phosphate dehydrogenase.
14614139 2003 Quantitative evolutionary design of glucose 6-phosphate dehydrogenase expression in human erythrocytes.
12972027 Glucose-6-phosphate dehydrogenase (G6PD) mutations and UDP-glucuronosyltransferase promoter polymorphism among G6PD deficient Kuwaitis.
12921788 2003 Glycolaldehyde induces apoptosis in a human breast cancer cell line.
12850494 Glucose-6-phosphate dehydrogenase (G-6-PD) mutations in Mexico: four new G-6-PD variants.
12768444 2003 Two cases of glucose-6-phosphate dehydrogenase-deficient Nepalese belonging to the G6PD Mediterranean-type, not India-Pakistan sub-type but Mediterranean-Middle East sub-type.
12737943 Combined glucose-6-phosphate dehydrogenase and glucosephosphate isomerase deficiency can alter clinical outcome.
12737940 Molecular characterization of G6PD Insuli--a novel 989 CGC --> CAC (330 Arg --> His) mutation in the Indian population.
12737938 Mild hemolysis in a girl with G6PD Sumaré (class I variant) associated with G6PD A-.
12696079 2003 Glucose-6-phosphate dehydrogenase deficiency does not result from mutations in the promoter region of the G6PD gene.
12680285 [Glucose-6-phosphate dehydrogenase deficiency, neonatal hyperbilirubinemia and Gilbert syndrome].
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12641410 2003 Human genetic polymorphisms and asymptomatic Plasmodium falciparum malaria in Gabonese schoolchildren.
12616531 2003 Same origins of DNA replication function on the active and inactive human X chromosomes.
12588050 2002 Decreased blood activity of glucose-6-phosphate dehydrogenase associates with increased risk for diabetes mellitus.
12524354 2002 Nucleotide variability at G6pd and the signature of malarial selection in humans.
12497642 2003 Glucose-6-phosphate dehydrogenase (G6PD) variants in Malaysian Malays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439228 2002 Coinheritance of variant UDP-glucuronosyl transferase 1A1 gene and glucose-6-phosphate dehydrogenase deficiency in adults with hyperbilirubinemia.
12380870 2002 Molecular epidemiology and activity of erythrocyte G6PD variants in a homogeneous Nigerian population.
12378426 2002 Evidence for balancing selection from nucleotide sequence analyses of human G6PD.
12135480 2002 Recombinant human glucose-6-phosphate dehydrogenase. Evidence for a rapid-equilibrium random-order mechanism.
12130518 2002 Deletion of leucine 61 in glucose-6-phosphate dehydrogenase leads to chronic nonspherocytic anemia, granulocyte dysfunction, and increased susceptibility to infections.
12027950 2002 Cell growth and cholesterol metabolism in human glucose-6-phosphate dehydrogenase deficient lymphomononuclear cells.
11920200 2000 Molecular basis of haemoglobinopathies and G6PD deficiency in the Comorian population.
11877026 2000 [The preliminary study on the gene mutations of sixty patients with G6PD deficiency in Yunnan province].
11876979 2000 [Comparative study of three common G6PD gene mutations in Yao and Han People in Guangxi].
11857737 2002 G6PDdb, an integrated database of glucose-6-phosphate dehydrogenase (G6PD) mutations.
11499668 2001 Distribution of glucose-6-phosphate dehydrogenase mutations in Southeast Asia.
11440553 2001 Cytochemically detectable glucose-6-phosphate dehydrogenase is present in human fetal membrane chorion laeve trophoblasts.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11237690 2001 Purification and some properties of human placental glucose-6-phosphate dehydrogenase.
11112389 2000 A new exon 9 glucose-6-phosphate dehydrogenase mutation (G6PD "Rehovot") in a Jewish Ethiopian family with variable phenotypes.
11042039 2000 Glucose-6-phosphate dehydrogenase mutations and haplotypes in Mexican Mestizos.
11024211 2000 1376G-->T mutation of G6PD gene in Han and Li nationalities in Hainan, China.
10745013 2000 Human glucose-6-phosphate dehydrogenase: the crystal structure reveals a structural NADP(+) molecule and provides insights into enzyme deficiency.
10698963 2000 Human mutations in glucose 6-phosphate dehydrogenase reflect evolutionary history.
10627140 1998 A new glucose 6 phosphate dehydrogenase variant G6PD Sinnai (34 G-->T). Mutations in brief no. 156. Online.
10089300 1999 Solution of the structure of tetrameric human glucose 6-phosphate dehydrogenase by molecular replacement.
10087986 1998 Two mechanisms for toxic effects of hydroxylamines in human erythrocytes: involvement of free radicals and risk of potentiation.
9452072 1998 G6PD Mount Sinai: a new severe hemolytic variant characterized by dual mutations at nucleotides 376G and 1159T (N126D).
9233561 1997 Molecular characterization of G6PD deficiency in Southern Italy: heterogeneity, correlation genotype-phenotype and description of a new variant (G6PD Neapolis).
8826878 1996 New insights into G6PD deficiency.
8733135 1996 Long-range sequence analysis in Xq28: thirteen known and six candidate genes in 219.4 kb of high GC DNA between the RCP/GCP and G6PD loci.
8533762 1995 A new glucose-6-phosphate dehydrogenase variant, G6PD Orissa (44 Ala-->Gly), is the major polymorphic variant in tribal populations in India.
8490627 1993 G6PD Aures: a new mutation (48 Ile-->Thr) causing mild G6PD deficiency is associated with favism.
8466644 1993 5' structure and expression of human glucose-6-phosphate dehydrogenase mRNA.
8364584 1993 Variants of glucose-6-phosphate dehydrogenase are due to missense mutations spread throughout the coding region of the gene.
8356804 1993 Enhanced activity of human G6PD promoter transfected in HeLa cells producing high levels of HIV-1 Tat.
8193373 1994 Molecular study of eight Japanese cases of glucose-6-phosphate dehydrogenase deficiency by nonradioisotopic single-strand conformation polymorphism analysis.
7959695 1994 A novel single-base mutation in the glucose 6-phosphate dehydrogenase gene is associated with chronic non-spherocytic haemolytic anaemia.
7858267 1995 New glucose-6-phosphate dehydrogenase mutations associated with chronic anemia.
7857286 1995 Glucose 6-phosphate dehydrogenase from human erythrocytes: identification of N-acetyl-alanine at the N-terminus of the mature protein.
7825590 1995 Multiple glucose 6-phosphate dehydrogenase-deficient variants correlate with malaria endemicity in the Vanuatu archipelago (southwestern Pacific).
6696761 1984 Amino acid sequence of the carboxy-terminal end of human erythrocyte glucose-6-phosphate dehydrogenase.
5666113 1968 Enzymic properties of different types of human erythrocyte glucose-6-phosphate dehydrogenase, with characterization of two new genetic variants.
5643703 1968 Biochemical variants of glucose-6-phosphate dehydrogenase giving rise to congenital nonspherocytic hemolytic disease.
3515319 1986 Isolation of human glucose-6-phosphate dehydrogenase (G6PD) cDNA clones: primary structure of the protein and unusual 5' non-coding region.
3446582 1987 A single nucleotide base transition is the basis of the common human glucose-6-phosphate dehydrogenase variant A (+).
3393536 1988 Diverse point mutations in the human glucose-6-phosphate dehydrogenase gene cause enzyme deficiency and mild or severe hemolytic anemia.
3126064 1988 Human erythrocyte glucose-6-phosphate dehydrogenase. Identification of a reactive lysyl residue labelled with pyridoxal 5'-phosphate.
3012556 1986 Human glucose-6-phosphate dehydrogenase: primary structure and cDNA cloning.
2912069 1989 Two point mutations are responsible for G6PD polymorphism in Sardinia.
2910917 1989 Alternative splicing of human glucose-6-phosphate dehydrogenase messenger RNA in different tissues.
2836867 1988 Molecular cloning and nucleotide sequence of cDNA for human glucose-6-phosphate dehydrogenase variant A(-).
2758468 1989 Two structural genes on different chromosomes are required for encoding the major subunit of human red cell glucose-6-phosphate dehydrogenase.
2428611 1986 Structural analysis of the X-linked gene encoding human glucose 6-phosphate dehydrogenase.
2420826 1986 Ribose metabolism and nucleic acid synthesis in normal and glucose-6-phosphate dehydrogenase-deficient human erythrocytes infected with Plasmodium falciparum.
2297768 1990 Sex steroid hormone modulation of NADPH pathways in MCF-7 cells.
1945893 1991 A to G substitution identified in exon 2 of the G6PD gene among G6PD deficient Chinese.
1889820 1991 Sequence of human glucose-6-phosphate dehydrogenase cloned in plasmids and a yeast artificial chromosome.
1874446 1991 The CpG island in the 5' region of the G6PD gene of man and mouse.
1611091 1992 New glucose-6-phosphate dehydrogenase mutations from various ethnic groups.
1536798 1992 Molecular basis of chronic non-spherocytic haemolytic anaemia: a new G6PD variant (393 Arg----His) with abnormal KmG6P and marked in vivo instability.
1303182 1992 G6PD Kalyan and G6PD Kerala; two deficient variants in India caused by the same 317 Glu-->Lys mutation.
1303180 1992 A novel C to T substitution at nucleotide 1360 of cDNA which abolishes a natural Hha I site accounts for a new G6PD deficiency gene in Chinese.
743300 1978 Glucose 6-phosphate dehydrogenase activity in membranes of erythrocytes from normal individuals and subjects with Mediterranean G6PD deficiency.