Property Summary

Ligand Count 2
NCBI Gene PubMed Count 315
PubMed Score 10.80
PubTator Score 6611.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.200 2.8e-03
Breast cancer 1.500 2.4e-07
glioblastoma 1.500 8.7e-04
invasive ductal carcinoma 1.200 2.1e-02
lung cancer 1.300 5.8e-03
psoriasis 1.900 5.6e-04
subependymal giant cell astrocytoma 1.181 2.8e-02
tuberculosis 1.900 1.4e-07

Gene RIF (274)

AA Sequence

MAEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGY      1 - 70
ARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYL     71 - 140
ALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIDHYLGKEMVQN    141 - 210
LMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTN    211 - 280
SDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWD    281 - 350
GVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL    351 - 420
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPT    421 - 490
EADELMKRVGFQYEGTYKWVNPHKL                                                 491 - 515
//

Text Mined References (325)

PMID Year Title