Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Keratosis 37 3.622 1.8

 Compartment GO Term (0)

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQ      1 - 70
LLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG                              71 - 115
//

Text Mined References (6)

PMID Year Title