Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Keratosis 34 3.617 1.8

Synonym

Accession G3V211 F8VRL5 F8VVU4
Symbols C12orf79

Gene

 Compartment GO Term (0)

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQ      1 - 70
LLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG                              71 - 115
//

Text Mined References (5)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.