Property Summary

NCBI Gene PubMed Count 70
PubMed Score 103.61
PubTator Score 80.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.300 8.1e-03
hepatocellular carcinoma 1.500 3.1e-05
pancreatic cancer 1.100 2.6e-02
Waldenstrons macroglobulinemia 1.221 4.1e-03
psoriasis 1.100 2.0e-06
glioblastoma 1.200 1.5e-03
osteosarcoma 1.375 3.1e-04
medulloblastoma 1.200 6.7e-04
astrocytoma 1.400 4.2e-03
atypical teratoid / rhabdoid tumor 1.200 4.5e-07
medulloblastoma, large-cell 2.200 1.4e-06
ulcerative colitis -1.243 3.7e-02
acute quadriplegic myopathy 1.587 2.5e-08
tuberculosis and treatment for 6 months -1.700 3.7e-05
intraductal papillary-mucinous adenoma (... 1.100 1.5e-02
intraductal papillary-mucinous carcinoma... 1.200 6.6e-03
Breast cancer 3.300 3.7e-02
primary Sjogren syndrome 1.100 5.7e-03
pancreatic carcinoma 1.100 2.6e-02
lung adenocarcinoma 1.186 6.6e-06
ovarian cancer 1.900 1.5e-04

Gene RIF (45)

PMID Text
27022092 G3BP mediates the condensation of stress granules by shifting between two different states that are controlled by the phosphorylation of S149 and by binding to Caprin1 or USP10.
26432022 Host G3BP1 captures HIV-1 RNA transcripts and thereby restricts mRNA translation, viral protein production and virus particle formation.
26350772 G3BP1 granules were assembled independently of TIA-1 and had a negative impact on Dengue virus replication.
25962958 Our findings identified a novel function of G3BP1 in the progression of breast cancer via activation of the epithelial-to-mesenchymal transition
25847539 G3BP1 is essential for normal stress granule-processing body interactions and stress granule function.
25809930 Our data define G3BP1 as a novel independent prognostic factor that is correlated with gastric cancer progression.
25800057 these findings demonstrate a critical role for YB-1 in stress granule formation through translational activation of G3BP1, and highlight novel functions for stress granules in tumor progression.
25784705 The G3BP1-Caprin1-PKR complex represents a new mode of PKR activation and is important for antiviral activity of G3BP1 and PKR during infection with mengovirus.
25658430 ICP8 binding to G3BP also inhibits SG formation, which is a novel function of HSV ICP8.
25653451 Stress granule components G3BP1 and G3BP2 play a proviral role early in Chikungunya virus replication.
25578447 eQTLs acting across multiple tissues are significant carriers of inherited risk for CAD. FLYWCH1, PSORSIC3, and G3BP1 are novel master regulatory genes in CAD that may be suitable targets.
25520508 Authors show that the PXXP domain within G3BP1 is essential for the recruitment of PKR to stress granules, for eIF2alpha phosphorylation driven by PKR, and for nucleating stress granules of normal composition.
25496916 HIV-1 Gag co-localizes and interacts with G3BP1 and TIAR to modulate stress granule assembly during HIV-1 infection
25352557 HIV-1 Gag co-localizes and interacts with G3BP1 and TIAR to modulate stress granule assembly during HIV-1 infection
25229650 G3BP1 has a role in modulating stress granule assembly during HIV-1 infection
25229650 HIV-1 Gag co-localizes and interacts with G3BP1 and TIAR to modulate stress granule assembly during HIV-1 infection
24998844 These findings disclose a novel mechanism of resveratrol-induced p53 activation and resveratrol-induced apoptosis by direct targeting of G3BP1.
24992036 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24324649 Binding motifs specificity has been determined for human G3BP1 NTF2-like domain.
24321297 G3BP1 regulation of cell proliferation in breast cancer cells, may occur via a regulatory effect on PMP22 expression.
24157923 Data revealed that knockdown of G3BP inhibited the migration and invasion of human lung carcinoma cells through the inhibition of Src, FAK, ERK and NF-kappaB and decreased levels of MMP-2, MMP-9 and uPA.
23279204 both G3BP1 and G3BP2 play a role in the formation of SGs in various human cells and thereby recovery from these cellular stresses.
23163895 MK-STYX inhibits stress granule formation independently of G3BP-1 phosphorylation at Ser149.
23087212 Data show that the nsP3/G3BP interaction also blocks stress granules (SGs) induced by other stresses than virus infection.
22833567 Data indicate that assembly of large RasGAP SH3-binding protein (G3BP)-induced stress granules precedes phosphorylation of eukaryotic initiation factor 2alpha (eIF2alpha).
22767504 These findings establish a novel function for Poly(ADP-ribose) in the formation of G3BP-induced stress granules upon genotoxic stress.
22703643 In this report, we demonstrate that a novel peptide GAP161 blocked the functions of G3BP and markedly suppressed HCT116 cell growth through the induction of apoptosis
22205990 arguments against G3BP1 being a genuine RasGAP-binding partner
22190034 HIV-1 Gag co-localizes and interacts with G3BP1 and TIAR to modulate stress granule assembly during HIV-1 infection
21665939 overexpression of the amino (N)-terminal region of G3BP, including the binding region for BART mRNA, dominant-negatively inhibits formation of the complex between endogenous G3BP and BART mRNA, and increases the expression of BART.
21304914 interaction between IncA and G3BP1 of Hep-2 cells infected with Chlamydophila psittaci reduces c-Myc concentration
21266361 CD24 may play a role in the inhibition of cell invasion and metastasis, and that intracellular CD24 inhibits invasiveness and metastasis through its influence on the posttranscriptional regulation of BART mRNA levels via G3BP RNase activity.
21257637 TAR DNA-binding protein 43 (TDP-43) regulates stress granule dynamics via differential regulation of G3BP and TIA-1.
21206022 The nuclear transport factor 2-like (NTF2-like) domain of human G3BP1 was subcloned, overexpressed in Escherichia coli and purified.
20663914 Molecular and functional studies indicate that the interaction of G3BP1 with beta-F1 mRNA inhibits its translation at the initiation level, supporting a role for G3BP1 in the glycolytic switch that occurs in cancer.
20643132 The kinetics of assembly of stress granules(SGs) in living cells demonstrated that Tudor-SN co-localizes with G3BP and is recruited to the same SGs in response to different stress stimuli.
20424128 these results strongly indicate that (-)-epigallocatechin gallate suppresses lung tumorigenesis through its binding with G3BP1
20180778 Results illustrated a role for MK-STYX in regulating the ability of G3BP1 to integrate changes in growth-factor stimulation and environmental stress with the regulation of protein synthesis.
17696235 The expression of G3BP and RhoC protein is closely related to the lymph node metastasis and survival in esophageal squamous carcinoma (ESC) patients. G3BP and RhoC proteins can be considered as predictors of prognosis in ESC patients.
17297477 Both G3BP1 and G3BP2 isoforms may act as negative regulators of tumor suppressor protein p53.
17253181 The expressions of G3BP and OPN proteins have a close relationship with lymphoid metastasis and survival in esophageal squamous carcinoma patients.
17210633 Caprin-1/G3BP-1 complex is likely to regulate the transport and translation of mRNAs of proteins involved with synaptic plasticity in neurons
16996479 Hepatitis C virus viral gene and proteins may regulate the presence of host cellular proteins in detergent resistant membrane
15602692 G3BPs are scaffolding proteins linking signal transduction to RNA metabolism (review)
15471883 involvement of cellular protein G3BP in transcription of intermediate stage genes may regulate the transition between early and late phases of vaccinia virus replication

AA Sequence

MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF      1 - 70
TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGG     71 - 140
FVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEI    141 - 210
QEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPAS    211 - 280
QPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHE    281 - 350
VDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE    351 - 420
GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ                            421 - 466
//

Text Mined References (91)

PMID Year Title
27022092 2016 G3BP-Caprin1-USP10 complexes mediate stress granule condensation and associate with 40S subunits.
26432022 2015 G3BP1 restricts HIV-1 replication in macrophages and T-cells by sequestering viral RNA.
26350772 2015 Dengue virus infection induces formation of G3BP1 granules in human lung epithelial cells.
25962958 2015 Involvement of Ras GTPase-activating protein SH3 domain-binding protein 1 in the epithelial-to-mesenchymal transition-induced metastasis of breast cancer cells via the Smad signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847539 2015 G3BP1 promotes stress-induced RNA granule interactions to preserve polyadenylated mRNA.
25809930 2015 Overexpression of Ras-GTPase-activating protein SH3 domain-binding protein 1 correlates with poor prognosis in gastric cancer patients.
25800057 2015 YB-1 regulates stress granule formation and tumor progression by translationally activating G3BP1.
25784705 2015 Stress granules regulate double-stranded RNA-dependent protein kinase activation through a complex containing G3BP1 and Caprin1.
25658430 2015 Viral and cellular proteins containing FGDF motifs bind G3BP to block stress granule formation.
25653451 2015 Stress granule components G3BP1 and G3BP2 play a proviral role early in Chikungunya virus replication.
25578447 2015 Expression quantitative trait Loci acting across multiple tissues are enriched in inherited risk for coronary artery disease.
25520508 2015 The stress granule protein G3BP1 recruits protein kinase R to promote multiple innate immune antiviral responses.
25229650 2014 eEF2 and Ras-GAP SH3 domain-binding protein (G3BP1) modulate stress granule assembly during HIV-1 infection.
24998844 2015 Resveratrol induces apoptosis by directly targeting Ras-GTPase-activating protein SH3 domain-binding protein 1.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24324649 2013 Crystal structures of the human G3BP1 NTF2-like domain visualize FxFG Nup repeat specificity.
24321297 2013 Regulation of PMP22 mRNA by G3BP1 affects cell proliferation in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24157923 2013 Downregulation of G3BPs inhibits the growth, migration and invasion of human lung carcinoma H1299 cells by suppressing the Src/FAK-associated signaling pathway.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23953116 2013 Inhibition of mTORC1 by astrin and stress granules prevents apoptosis in cancer cells.
23279204 2013 Both G3BP1 and G3BP2 contribute to stress granule formation.
23209657 2012 Ataxin-2-like is a regulator of stress granules and processing bodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163895 2013 The pseudophosphatase MK-STYX inhibits stress granule assembly independently of Ser149 phosphorylation of G3BP-1.
23087212 2012 Sequestration of G3BP coupled with efficient translation inhibits stress granules in Semliki Forest virus infection.
22833567 2012 Large G3BP-induced granules trigger eIF2? phosphorylation.
22767504 2012 Quantitative proteomics and dynamic imaging reveal that G3BP-mediated stress granule assembly is poly(ADP-ribose)-dependent following exposure to MNNG-induced DNA alkylation.
22703643 2012 GAP161 targets and downregulates G3BP to suppress cell growth and potentiate cisplaitin-mediated cytotoxicity to colon carcinoma HCT116 cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22205990 2011 Revisiting G3BP1 as a RasGAP binding protein: sensitization of tumor cells to chemotherapy by the RasGAP 317-326 sequence does not involve G3BP1.
21665939 2011 The N-terminal domain of G3BP enhances cell motility and invasion by posttranscriptional regulation of BART.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21304914 2011 Functional interaction between type III-secreted protein IncA of Chlamydophila psittaci and human G3BP1.
21269460 2011 Initial characterization of the human central proteome.
21266361 2011 Intracellular CD24 inhibits cell invasion by posttranscriptional regulation of BART through interaction with G3BP.
21257637 2011 TAR DNA-binding protein 43 (TDP-43) regulates stress granule dynamics via differential regulation of G3BP and TIA-1.
21206022 2011 Purification, crystallization and preliminary X-ray diffraction of the G3BP1 NTF2-like domain.
20663914 2010 Human G3BP1 interacts with beta-F1-ATPase mRNA and inhibits its translation.
20643132 2010 Tudor-SN interacts with and co-localizes with G3BP in stress granules under stress conditions.
20424128 2010 Epigallocatechin gallate suppresses lung cancer cell growth through Ras-GTPase-activating protein SH3 domain-binding protein 1.
20180778 2010 The pseudophosphatase MK-STYX interacts with G3BP and decreases stress granule formation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17696235 2007 Expression of G3BP and RhoC in esophageal squamous carcinoma and their effect on prognosis.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17297477 2007 Modulation of p53 and MDM2 activity by novel interaction with Ras-GAP binding proteins (G3BP).
17253181 2007 [Expression of Ras-GTPase-activating protein SH 3 domain binding protein and osteopontin in esophageal squamous carcinoma and their effects on prognosis].
17210633 2007 Distinct structural features of caprin-1 mediate its interaction with G3BP-1 and its induction of phosphorylation of eukaryotic translation initiation factor 2alpha, entry to cytoplasmic stress granules, and selective interaction with a subset of mRNAs.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16996479 2006 Subproteomic study of hepatitis C virus replicon reveals Ras-GTPase-activating protein binding protein 1 as potential HCV RC component.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15743820 2005 Removal of C-terminal SRC kinase from the immune synapse by a new binding protein.
15602692 2004 Rasputin, more promiscuous than ever: a review of G3BP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471883 2004 Vaccinia virus intermediate stage transcription is complemented by Ras-GTPase-activating protein SH3 domain-binding protein (G3BP) and cytoplasmic activation/proliferation-associated protein (p137) individually or as a heterodimer.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12642610 2003 The RasGAP-associated endoribonuclease G3BP assembles stress granules.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11888885 2002 Heregulin induces expression, ATPase activity, and nuclear localization of G3BP, a Ras signaling component, in human breast tumors.
11604510 2001 RasGAP-associated endoribonuclease G3Bp: selective RNA degradation and phosphorylation-dependent localization.
11439350 2001 Ras-GAP SH3 domain binding protein (G3BP) is a modulator of USP10, a novel human ubiquitin specific protease.
10404389 1999 Upregulation of the RAS-GTPase activating protein (GAP)-binding protein (G3BP) in proliferating RPE cells.
9889278 1999 Human DNA helicase VIII: a DNA and RNA helicase corresponding to the G3BP protein, an element of the ras transduction pathway.
9632780 1998 A novel phosphorylation-dependent RNase activity of GAP-SH3 binding protein: a potential link between signal transduction and RNA stability.
8649363 1996 A Ras-GTPase-activating protein SH3-domain-binding protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1461655 1992 Rearrangement of the human tre oncogene by homologous recombination between Alu repeats of nucleotide sequences from two different chromosomes.