Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.67
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.934 8.7e-05
group 3 medulloblastoma 1.600 1.7e-05
medulloblastoma, large-cell 1.400 7.7e-06
adrenocortical carcinoma 1.103 8.9e-03
non-small cell lung cancer 1.274 3.6e-18
intraductal papillary-mucinous carcinoma... 1.200 4.6e-02
psoriasis -1.300 3.5e-09
ovarian cancer 2.200 2.5e-06

Gene RIF (2)

PMID Text
25593194 Results suggest that G2E3 is a molecular determinant of the DDR and cell survival.
17239372 Cell cycle phase-specific expression and highly regulated subcellular localization of G2E3 suggest a possible role in cell cycle regulation and the cellular response to DNA damage.

AA Sequence

MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIR      1 - 70
KEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRE     71 - 140
SLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAINAGVFFFRCTICNNSDIFQKEMLRMGIHIP    141 - 210
EKDASWELEENAYQELLQHYERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNW    211 - 280
ECLECRGIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLL    281 - 350
IELGFQIKKKTKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL    351 - 420
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPENTQPILDDVS    421 - 490
DFDVAQIIIRINTATTVADLKSIINECYNYLELIGCLRLITTLSDKYMLVKDILGYHVIQRVHTPFESFK    491 - 560
QGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSELFTVHTLPDVKALGFWNSYLQAVEDGKSTTTME    561 - 630
DILIFATGCSSIPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLEKEES    631 - 700
SHYIGH                                                                    701 - 706
//

Text Mined References (14)

PMID Year Title
25593194 2015 Screening analysis of ubiquitin ligases reveals G2E3 as a potential target for chemosensitizing cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
18511420 2008 G2E3 is a dual function ubiquitin ligase required for early embryonic development.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17239372 2007 G2E3 is a nucleo-cytoplasmic shuttling protein with DNA damage responsive localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483598 2001 The G(2) DNA damage checkpoint delays expression of genes encoding mitotic regulators.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.