Property Summary

NCBI Gene PubMed Count 25
PubMed Score 52.49
PubTator Score 34.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma -1.874 2.5e-02
aldosterone-producing adenoma -1.329 1.6e-02
Atopic dermatitis -2.000 4.4e-03
breast carcinoma -2.700 1.2e-03
chronic lymphosyte leukemia -1.600 5.5e-09
colon cancer 1.200 1.3e-03
cutaneous lupus erythematosus 1.200 3.6e-02
cystic fibrosis 2.371 3.1e-05
Duchenne muscular dystrophy -1.416 3.2e-04
ductal carcinoma in situ -4.000 1.8e-04
fibroadenoma -2.900 2.1e-02
gastric cancer -2.100 3.1e-02
glioblastoma 1.200 1.3e-03
hepatocellular carcinoma -2.700 7.1e-04
intraductal papillary-mucinous adenoma (... -1.800 4.0e-05
intraductal papillary-mucinous carcinoma... -1.900 1.2e-03
invasive ductal carcinoma -5.000 2.9e-05
lung adenocarcinoma -1.254 6.5e-04
lung cancer -2.700 1.6e-06
lung carcinoma -1.300 1.9e-13
malignant mesothelioma -4.400 8.8e-10
mucosa-associated lymphoid tissue lympho... 1.273 9.3e-03
non primary Sjogren syndrome sicca 1.400 2.4e-02
non-small cell lung cancer -1.725 9.9e-10
ovarian cancer -1.100 6.2e-03
psoriasis 1.400 8.1e-04
sonic hedgehog group medulloblastoma -1.100 1.2e-03
tuberculosis -2.100 8.8e-03
ulcerative colitis 2.800 1.0e-04

Gene RIF (19)

AA Sequence

METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL      1 - 70
ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS                                          71 - 103
//

Text Mined References (25)

PMID Year Title