Property Summary

NCBI Gene PubMed Count 49
PubMed Score 58.74
PubTator Score 10.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Polyploidy 3
Disease Target Count P-value
osteosarcoma 7933 2.3e-07
psoriasis 6685 1.5e-04
Disease Target Count Z-score Confidence
Asbestosis 10 3.579 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 1.5e-04
osteosarcoma -1.997 2.3e-07

Gene RIF (16)

PMID Text
23613471 Cdh1 contributes to spatiotemporal organization of AurB activity, and organization of FHOD1 activity by AurB contributes to daughter cell spreading after mitosis.
23029325 Anaphase-promoting complex/cyclosome-CDH1, rather than Cdc20, promotes the degradation of BRSK2 in vivo.
20921411 Anaphase-promoting complex/cyclosome-Cdh1 coordinates glycolysis and glutaminolysis with transition to S phase in human T lymphocytes.
20530197 Cdh1-depleted HeLa cells reduced stress fiber formation significantly. The GTP-bound active Rho protein was apparently decreased in the Cdh1-depleted cells.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19861496 FZR1 is not required for the completion of mitosis, but is an important regulator of G1 phase and is required for efficient DNA replication in human and mouse somatic cells.
18662541 In response to genotoxic stress in G2, the phosphatase Cdc14B translocates from the nucleolus to the nucleoplasm and induces the activation of the ubiquitin ligase APC/C(Cdh1), with the consequent degradation of Plk1, a prominent mitotic kinase.
18381934 Study shows a correlation between Skp2 and APC(Cdh1) in breast cancer. Cdh1 may act as an important component in tumor suppression and could be considered as a novel biomarker in breast cancer.
18321983 during endocycles, APC/C Fzr/Cdh1 functions to reduce the levels of the mitotic cyclins and Geminin in order to facilitate the relicensing of DNA replication origins and cell cycle progression
18212744 Retinoic acid downregulates Rae1, hence facilitating APC(Cdh1)-mediated Skp2 degradation leading to the arrest of cell cycle progression and neuroblastoma differentiation.
18174259 Acute UV radiation triggers proteolysis of CDH1, an activator of APC, which is involved in regulation of apoptosis induced by UV radiation.
17339342 Data show that degradation of TMAP/CKAP2 during mitotic exit is mediated by the anaphase-promoting complex bound to Cdh1 and that the KEN box motif near the N terminus is necessary for its destruction.
17283060 identify a novel mechanism for tumor suppression by TGF-beta and explain why dysfunction of APC in the TGF-beta pathway in responsive cells is associated with cancer.
17215516 Cdh1/APC is crucial to the coordination of cell cycle progression and the initiation of lens differentiation through mediating TGF-beta-signaling-induced destruction of SnoN.
15029244 Results indicate that Cdh1 mediates its own degradation by activating the anaphase-promoting complex/cyclosome to degrade itself.
12198152 Destruction-box specificities of APC/C(fzy) and APC/C(fzr)& successive activation of APC/C by fzy & fzr establish the temporal substrate degradation pattern, explaining why some endogenous RXXL substrates are degraded by fzy & others by fzr complexes.

AA Sequence

MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS      1 - 70
PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD     71 - 140
DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY    141 - 210
LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN    211 - 280
AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ    281 - 350
YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY    351 - 420
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLN    421 - 490
LFTRIR                                                                    491 - 496
//

Text Mined References (55)

PMID Year Title
23613471 2013 Spatiotemporal organization of Aurora-B by APC/CCdh1 after mitosis coordinates cell spreading through FHOD1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029325 2012 APC/C(Cdh1) targets brain-specific kinase 2 (BRSK2) for degradation via the ubiquitin-proteasome pathway.
22770219 2012 Acetylation-dependent regulation of Skp2 function.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22014574 2011 SIRT2 maintains genome integrity and suppresses tumorigenesis through regulating APC/C activity.
21986944 2012 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/CCDH1.
21596315 2011 Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
20921411 2010 Anaphase-promoting complex/cyclosome-Cdh1 coordinates glycolysis and glutaminolysis with transition to S phase in human T lymphocytes.
20802534 2011 Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor.
20530197 2010 The anaphase-promoting complex/cyclosome activator Cdh1 modulates Rho GTPase by targeting p190 RhoGAP for degradation.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20424596 2010 Proteolysis of Rad17 by Cdh1/APC regulates checkpoint termination and recovery from genotoxic stress.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19861496 2009 Loss of the mammalian APC/C activator FZR1 shortens G1 and lengthens S phase but has little effect on exit from mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18662541 2008 The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint.
18381934 2008 Dissection of the APCCdh1-Skp2 cascade in breast cancer.
18321983 2008 APC/CFzr/Cdh1 promotes cell cycle progression during the Drosophila endocycle.
18212744 2008 Retinoic acid downregulates Rae1 leading to APC(Cdh1) activation and neuroblastoma SH-SY5Y differentiation.
18174259 2008 Proteolysis of CDH1 enhances susceptibility to UV radiation-induced apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17719540 2007 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling.
17403670 2007 Cell cycle-dependent expression of centrosomal ninein-like protein in human cells is regulated by the anaphase-promoting complex.
17339342 2007 Functional importance of the anaphase-promoting complex-Cdh1-mediated degradation of TMAP/CKAP2 in regulation of spindle function and cytokinesis.
17283060 2007 Cdh1-anaphase-promoting complex targets Skp2 for destruction in transforming growth factor beta-induced growth inhibition.
17215516 2007 The anaphase-promoting complex coordinates initiation of lens differentiation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469984 2004 Plk1 regulates activation of the anaphase promoting complex by phosphorylating and triggering SCFbetaTrCP-dependent destruction of the APC Inhibitor Emi1.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
15014503 2004 Degradation of the SCF component Skp2 in cell-cycle phase G1 by the anaphase-promoting complex.
12797865 2003 Differential expression, localization and activity of two alternatively spliced isoforms of human APC regulator CDH1.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12560341 2003 Nuclear localization of the cell cycle regulator CDH1 and its regulation by phosphorylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198152 2002 Timing of APC/C substrate degradation is determined by fzy/fzr specificity of destruction boxes.
11988738 2002 E2F-dependent accumulation of hEmi1 regulates S phase entry by inhibiting APC(Cdh1).
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11691834 2001 Smad3 recruits the anaphase-promoting complex for ubiquitination and degradation of SnoN.
11598127 2001 Regulation of the anaphase-promoting complex by the dual specificity phosphatase human Cdc14a.
11459826 2001 MAD2B is an inhibitor of the anaphase-promoting complex.
11459825 2001 Inhibition of Cdh1-APC by the MAD2-related protein MAD2L2: a novel mechanism for regulating Cdh1.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11003657 2000 Nonperiodic activity of the human anaphase-promoting complex-Cdh1 ubiquitin ligase results in continuous DNA synthesis uncoupled from mitosis.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10500174 1999 Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
10459014 1999 Regulation of APC activity by phosphorylation and regulatory factors.
9811605 1998 Activation of the human anaphase-promoting complex by proteins of the CDC20/Fizzy family.
9734353 1998 Direct binding of CDC20 protein family members activates the anaphase-promoting complex in mitosis and G1.