Property Summary

NCBI Gene PubMed Count 21
PubMed Score 59.75
PubTator Score 26.78

Knowledge Summary

Patent (2,489)

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 3.2e-03
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.842 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.2e-03

Gene RIF (10)

PMID Text
20501643 The activity of the Sprouty4 promoter is increased by Wnt7A/Fzd9 signaling through peroxisome proliferator-activated receptor gamma in lung cancer cells.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and that the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20398908 Observational study of gene-disease association. (HuGE Navigator)
19724923 SiRNA of frizzled-9 suppresses proliferation and motility of hepatoma cells.
19543507 Observational study of gene-disease association. (HuGE Navigator)
19038973 The results suggest that WNT2 could act through its receptor FZD9 to regulate the beta-CATENIN pathway in cumulus cells, recruiting beta-CATENIN into plasma membranes and promoting the formation of adherens junctions involving CDH1.
18832655 Aberrant DNA methylation of frizzled 9 protein is associated with myelodysplastic syndrome progression to acute myeloid leukemia.
16835228 ERK5-dependent activation of PPARgamma represents a major effector pathway mediating the anti-tumorigenic effects of Wnt 7a and Fzd 9 in non-small cell lung cancer cells
15705594 transfection of Fzd-9 into a Wnt-7a-insensitive NSCLC cell line established Wnt-7a sensitivity

AA Sequence

MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAA      1 - 70
AELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCA     71 - 140
RLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKFQYVEKSRS    141 - 210
CAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLA    211 - 280
FLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEA    281 - 350
IEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG    351 - 420
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCAAAAG    421 - 490
PGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGS    491 - 560
YGRGTHCHYKAPTVVLHMTKTDPSLENPTHL                                           561 - 591
//

Text Mined References (21)

PMID Year Title
27509850 2016 A human neurodevelopmental model for Williams syndrome.
20501643 2010 Sprouty-4 inhibits transformed cell growth, migration and invasion, and epithelial-mesenchymal transition, and is regulated by Wnt7A through PPARgamma in non-small cell lung cancer.
20458727 2010 Expression profile of the embryonic markers nanog, OCT-4, SSEA-1, SSEA-4, and frizzled-9 receptor in human periodontal ligament mesenchymal stem cells.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19724923 2009 SiRNA of frizzled-9 suppresses proliferation and motility of hepatoma cells.
19543507 2009 Non-association between polymorphisms of the frizzled receptor genes and bone mineral density in postmenopausal Korean women.
19038973 2009 Identification of WNT/beta-CATENIN signaling pathway components in human cumulus cells.
18832655 2009 Aberrant DNA methylation is a dominant mechanism in MDS progression to AML.
16835228 2006 Antitumorigenic effect of Wnt 7a and Fzd 9 in non-small cell lung cancer cells is mediated through ERK-5-dependent activation of peroxisome proliferator-activated receptor gamma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15705594 2005 Restoration of Wnt-7a expression reverses non-small cell lung cancer cellular transformation through frizzled-9-mediated growth inhibition and promotion of cell differentiation.
15370539 2004 Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
14688793 2004 Mutant Frizzled 4 associated with vitreoretinopathy traps wild-type Frizzled in the endoplasmic reticulum by oligomerization.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138115 2002 Frizzled-9 is activated by Wnt-2 and functions in Wnt/beta -catenin signaling.
10198163 1999 Characterization and expression pattern of the frizzled gene Fzd9, the mouse homolog of FZD9 which is deleted in Williams-Beuren syndrome.
9707618 1998 A novel frizzled gene identified in human esophageal carcinoma mediates APC/beta-catenin signals.
9192640 1997 Purification and molecular cloning of a secreted, Frizzled-related antagonist of Wnt action.
9147651 1997 A novel human homologue of the Drosophila frizzled wnt receptor gene binds wingless protein and is in the Williams syndrome deletion at 7q11.23.
914765 1977 Viral hepatitis (Chandigarh study).