Property Summary

NCBI Gene PubMed Count 30
PubMed Score 36.29
PubTator Score 18.71

Knowledge Summary

Patent (16,171)

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.700 1.4e-02
ependymoma -1.800 2.3e-02
oligodendroglioma -1.700 1.6e-02
osteosarcoma -1.549 1.4e-02
cystic fibrosis 2.794 1.2e-06
atypical teratoid / rhabdoid tumor 2.100 9.5e-04
glioblastoma -1.600 5.1e-03
medulloblastoma, large-cell -1.500 3.1e-02
pediatric high grade glioma -1.200 2.0e-02
Breast cancer -1.700 7.4e-05
ovarian cancer -1.100 3.2e-03
psoriasis -1.200 2.7e-43

Protein-protein Interaction (5)

Gene RIF (11)

PMID Text
26797711 Frizzled-8 has an important pro-inflammatory role and suggest that its expression is related to chronic bronchitis.
26590425 Study concludes that expression of Fzd8 is repressed in multiple cancers and suggest it may have a role as a tumor suppressor.
25702574 report the discovery of a human-accelerated regulatory enhancer (HARE5) of FZD8, a receptor of the Wnt pathway implicated in brain development and size
25320014 c-Met upregulated FZD8 through the ERK/c-Fos cascade in HN-CSC. Taken together, our results offer a preclinical proof-of-concept for targeting the c-Met/FZD8 signaling axis as a CSC-directed therapy to improve HNSCC treatment
23815780 We demonstrated an activation of Wnt-2 signaling via the Frizzled-8 receptor in non-small cell lung cancer cells
22738385 APF has been shown to be a nine-residue frizzled-8 protein-related sialoglycopeptide. Subsequent research has gradually clarified the molecular mechanisms underlying the profound antiproliferative effect of APF.
22303445 Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors.
21872498 These observations suggest that c-Jun is involved in APF-mediated inhibition for bladder tumor cell growth
20634891 Observational study of gene-disease association. (HuGE Navigator)
20093360 analysis of the frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6
18505162 molecular model of the Wnt protein binding site on the surface of dimeric CRD domain of the Fzd8 receptor

AA Sequence

MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVH      1 - 70
QFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPE     71 - 140
QGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGGRGGGGGDAAAPPAR    141 - 210
GGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFW    211 - 280
IGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGA    281 - 350
GGAGGAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT    351 - 420
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLV    421 - 490
IYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPR    491 - 560
WEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWASKGAAVG    561 - 630
GGAGATAAGGGGGPGGGGGGGPGGGGGPGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV          631 - 694
//

Text Mined References (31)

PMID Year Title
26797711 2016 A pro-inflammatory role for the Frizzled-8 receptor in chronic bronchitis.
26590425 2015 K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.
25702574 2015 Human-chimpanzee differences in a FZD8 enhancer alter cell-cycle dynamics in the developing neocortex.
25320014 2014 Targeting the c-Met/FZD8 signaling axis eliminates patient-derived cancer stem-like cells in head and neck squamous carcinomas.
23815780 2013 Frizzled-8 receptor is activated by the Wnt-2 ligand in non-small cell lung cancer.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22738385 2012 Integration analysis of quantitative proteomics and transcriptomics data identifies potential targets of frizzled-8 protein-related antiproliferative factor in vivo.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22682250 2012 Complement C1q activates canonical Wnt signaling and promotes aging-related phenotypes.
22575959 2012 ZNRF3 promotes Wnt receptor turnover in an R-spondin-sensitive manner.
22303445 2012 Inhibition of Wnt/?-catenin signaling by a soluble collagen-derived frizzled domain interacting with Wnt3a and the receptors frizzled 1 and 8.
22138402 2012 Frizzled-8 as a putative therapeutic target in human lung cancer.
21872498 2013 c-Jun is involved in interstitial cystitis antiproliferative factor (APF)-induced growth inhibition of human bladder cancer T24 cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20093360 2010 Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6.
18505162 Molecular model of the Wnt protein binding site on the surface of dimeric CRD domain of the hFzd8 receptor.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18256285 2008 The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling.
16882988 2006 Solution structure of GOPC PDZ domain and its interaction with the C-terminal motif of neuroligin.
15454084 2004 Mammalian Ryk is a Wnt coreceptor required for stimulation of neurite outgrowth.
15370539 2004 Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11520064 2001 Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled.
11452312 2001 Insights into Wnt binding and signalling from the structures of two Frizzled cysteine-rich domains.
11448771 2001 Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6.
11295046 2001 Molecular cloning and characterization of human Frizzled-8 gene on chromosome 10p11.2.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11029007 2000 LDL-receptor-related proteins in Wnt signal transduction.
9192640 1997 Purification and molecular cloning of a secreted, Frizzled-related antagonist of Wnt action.
8626800 1996 A large family of putative transmembrane receptors homologous to the product of the Drosophila tissue polarity gene frizzled.