Property Summary

NCBI Gene PubMed Count 50
PubMed Score 55.94
PubTator Score 36.70

Knowledge Summary

Patent (12,167)

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytoma 1.900 4.6e-02
ependymoma 2.300 2.6e-02
psoriasis -1.700 6.0e-07
glioblastoma 2.700 4.0e-03
oligodendroglioma 1.200 7.2e-05
osteosarcoma 1.425 1.3e-02
cystic fibrosis -1.945 2.0e-06
atypical teratoid / rhabdoid tumor 2.400 6.8e-06
acute quadriplegic myopathy -1.506 9.0e-06
chronic kidney disease 1.100 4.5e-02
primary pancreatic ductal adenocarcinoma 1.201 8.0e-04
intraductal papillary-mucinous adenoma (... -2.700 2.8e-03
colon cancer -1.900 4.3e-02
lung cancer -2.100 4.5e-03
active Crohn's disease -1.087 2.7e-02
active ulcerative colitis -1.853 2.9e-03
interstitial cystitis -1.200 5.1e-03
group 3 medulloblastoma 2.400 2.6e-02
non primary Sjogren syndrome sicca 1.100 1.4e-02
subependymal giant cell astrocytoma -3.635 1.2e-02
nasopharyngeal carcinoma 1.600 4.7e-03
Breast cancer -2.800 3.0e-12
breast carcinoma -1.500 2.4e-21
Pick disease 1.400 6.8e-03
acute myeloid leukemia -1.100 2.2e-02
ovarian cancer -3.900 1.3e-08
pituitary cancer -2.900 8.1e-05

Gene RIF (32)

PMID Text
26808375 FZD7 activated JNK in melanoma cell lines in vitro and the expression of a dominant negative JNK suppressed metastasis formation in vivo, suggesting that FZD7 may promote metastatic growth of melanoma cells via activation of JNK
26744382 SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggested that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of Fzds
26703210 conclusion, our study suggests that miR-613 functions as a tumor suppressor, partially through targeting Fzd7, and is a potential therapeutic target for prostate cancer.
26498690 Data show that cell proliferation and tumor growth decreased significantly after transfection with the plasmid frizzled 7 protein (FZD7)-Shiga-like toxin I (Stx1).
25976503 High expression of FZD7 is associated with cervical cancer.
25740178 High FZD7 expression is associated with cell migration, invasion, and epithelial-mesenchymal transition of cervical cancer.
25313882 Expression of FZD7 was inversely correlated with miR-199a in both hepatocellular carcinoma tissues and cells and over-expression of miR-199a significantly down-regulates the expression of genes downstream of FZD7.
25241036 Data indicate that Wnt receptor Fzd7-dependent enhancement of Wnt signalling by DeltaNp63 governs tumour-initiating activity of the basal subtype of breast cancer.
25032869 Knockdown of FZD7 in Stem-A subtype of ovarian cancer cells showed reduced cell proliferation with an increase in the G0/G1 sub-population.
24897117 Frizzled 7 expression is positively regulated by SIRT1 and beta-catenin in breast cancer cells.
24474766 results demonstrate that FZD7 encodes a regulator of the pluripotent state and that hESCs require endogenous WNT/beta-catenin signaling through FZD7 to maintain an undifferentiated phenotype
24170316 finding suggests that Wnt signaling is one of the factors of LSC niche, and Fz7 helps to maintain the undifferentiated state of LSCs.
21532620 Our findings suggest that FZD7-involved canonical Wnt signaling pathway is essential for tumorigenesis of TNBC.
21314951 Extracellular domain of FZD7 (sFZD7) was tested for its functional activity to interact with Wnt3, its ability to inhibit Wnt3-mediated signaling.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19773752 FZD7 may be involved in enhancement of survival, invasion and metastatic capabilities of colon cancer cells through non-canonical Wnt signalling pathways as well as the canonical pathway.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19655379 Variable FZD7 expression in colorectal cancers indicates regulation by the tumour microenvironment.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19543507 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18681827 findings identify the WNT receptor FZD7 as a novel ES cell-specific surface antigen with a likely important role in the maintenance of ES cell self-renewal capacity
18676680 Observational study of gene-disease association. (HuGE Navigator)
18592008 FZD7-siRNA may be used as a therapeutic reagent for colorectal cancer.
18313787 a functional interaction between Wnt3 and FZD7 leading to activation of the Wnt/beta-catenin signaling pathway in HCC cells and may play a role during hepatocarcinogenesis.
18256285 Syntenin stimulates c-jun phosphorylation and modulates Frizzled 7 signaling, in particular the PKCalpha/CDC42 noncanonical Wnt signaling cascade.
18156211 sFRP-1 can interact with Wnt receptors Frizzled 4 and 7 on endothelial cells to transduce downstream to cellular machineries requiring Rac-1 activity in cooperation with GSK-3beta
17716656 These findings pinpoint calpain-1 as a regulator of Frizzled-7 turnover at the plasma membrane and reveal a link between Frizzled-7 cleavage and its activity.
17016432 During development, FZD7 orchestrates either migratory or epithelialization which implicate similar functional diversity for FZD7 during colorectal cancer devvelopment.
15901282 FZD7 plays a pivotal role in morphology transitions that are associated with colon tumor initiation and progression.

AA Sequence

MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNL      1 - 70
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGF     71 - 140
QWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSC    141 - 210
PRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMR    211 - 280
RFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMAS    281 - 350
SIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA    351 - 420
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYF    421 - 490
YEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRF    491 - 560
YHRLSHSSKGETAV                                                            561 - 574
//

Text Mined References (52)

PMID Year Title
27386966 2016 Frizzled 7 and PIP2 binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signalling.
26808375 2016 FRIZZLED7 Is Required for Tumor Inititation and Metastatic Growth of Melanoma Cells.
26744382 2016 Sorting nexin 27 interacts with Fzd7 and mediates Wnt signalling.
26703210 2016 MicroRNA-613 represses prostate cancer cell proliferation and invasion through targeting Frizzled7.
26498690 2015 Frizzled-7 promoter is highly active in tumors and promoter-driven Shiga-like toxin I inhibits hepatocellular carcinoma growth.
25976503 2015 MicroRNA-142-3p inhibits cell proliferation and invasion of cervical cancer cells by targeting FZD7.
25740178 2015 Down-regulation of Frizzled-7 expression inhibits migration, invasion, and epithelial-mesenchymal transition of cervical cancer cell lines.
25313882 2014 MiR-199a regulates cell proliferation and survival by targeting FZD7.
25241036 2014 ?Np63 promotes stem cell activity in mammary gland development and basal-like breast cancer by enhancing Fzd7 expression and Wnt signalling.
25032869 2014 FZD7 drives in vitro aggressiveness in Stem-A subtype of ovarian cancer via regulation of non-canonical Wnt/PCP pathway.
24897117 2014 Frizzled 7 expression is positively regulated by SIRT1 and ?-catenin in breast cancer cells.
24474766 2014 The WNT receptor FZD7 is required for maintenance of the pluripotent state in human embryonic stem cells.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24170316 2014 Frizzled 7 maintains the undifferentiated state of human limbal stem/progenitor cells.
21532620 2011 FZD7 has a critical role in cell proliferation in triple negative breast cancer.
21314951 2011 Soluble Frizzled-7 receptor inhibits Wnt signaling and sensitizes hepatocellular carcinoma cells towards doxorubicin.
20802536 2011 Direct interaction between NHERF1 and Frizzled regulates ?-catenin signaling.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19773752 2009 Down-regulation of frizzled-7 expression decreases survival, invasion and metastatic capabilities of colon cancer cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19655379 2010 Variable FZD7 expression in colorectal cancers indicates regulation by the tumour microenvironment.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19543507 2009 Non-association between polymorphisms of the frizzled receptor genes and bone mineral density in postmenopausal Korean women.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19388021 2009 Sequence requirement and subtype specificity in the high-affinity interaction between human frizzled and dishevelled proteins.
19188438 2009 Myocilin is a modulator of Wnt signaling.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18681827 2008 The WNT receptor FZD7 contributes to self-renewal signaling of human embryonic stem cells.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18592008 2008 Frizzled-7 as a potential therapeutic target in colorectal cancer.
18313787 2008 Functional interaction between Wnt3 and Frizzled-7 leads to activation of the Wnt/beta-catenin signaling pathway in hepatocellular carcinoma cells.
18256285 2008 The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling.
18215320 2008 Ror2 modulates the canonical Wnt signaling in lung epithelial cells through cooperation with Fzd2.
18156211 2008 Regulation of endothelial cell cytoskeletal reorganization by a secreted frizzled-related protein-1 and frizzled 4- and frizzled 7-dependent pathway: role in neovessel formation.
17716656 2007 Frizzled-7 turnover at the plasma membrane is regulated by cell density and the Ca(2+) -dependent protease calpain-1.
17224074 2007 Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas.
17016432 2007 Frizzled-7 dictates three-dimensional organization of colorectal cancer cell carcinoids.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15901282 2005 Frizzled-7 receptor ectodomain expression in a colon cancer cell line induces morphological change and attenuates tumor growth.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15370539 2004 Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
15195140 2004 MAGI-3 is involved in the regulation of the JNK signaling pathway as a scaffold protein for frizzled and Ltap.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067714 2002 Direct interaction of Frizzled-1, -2, -4, and -7 with PDZ domains of PSD-95.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
9813155 1998 Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7.
9707618 1998 A novel frizzled gene identified in human esophageal carcinoma mediates APC/beta-catenin signals.
9192640 1997 Purification and molecular cloning of a secreted, Frizzled-related antagonist of Wnt action.