Property Summary

NCBI Gene PubMed Count 30
PubMed Score 38.18
PubTator Score 24.98

Knowledge Summary

Patent (7,982)

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.100 2.9e-04
psoriasis 2.600 1.4e-04
osteosarcoma 2.950 3.1e-04
posterior fossa group B ependymoma 3.400 3.4e-14
glioblastoma 2.500 1.8e-03
group 3 medulloblastoma 1.900 3.5e-03
atypical teratoid / rhabdoid tumor 1.600 3.0e-02
primitive neuroectodermal tumor 1.500 9.2e-03
pediatric high grade glioma 2.500 9.0e-05
pilocytic astrocytoma 2.700 2.0e-08
aldosterone-producing adenoma -1.573 3.7e-02
acute myeloid leukemia -1.200 4.6e-02
ovarian cancer 1.100 2.3e-02

Gene RIF (18)

PMID Text
25772759 we found that FZD6 expression was negatively regulated by miR199a5p
24816679 The rs3808553 of FZD6 is obviously associated with neural tube defects in Han population of northern China
24657404 This study confirms our speculation that down-regulation of FZD6 by beta-Carotene is causally related to the observed up-regulation of cancer related genes
24500924 DVL is a master regulator of FZD6/G-protein signaling
23748645 It is associated with poor prognosis in glioblastoma patients.
23374899 FZD6 should be screened for pachyonychia congenita as it is a candidate gene for hereditary nail dysplasias.
22861124 sequence analysis revealed a novel homozygous missense mutation (c.1266G>A; p.Gly422Asp) located in the transmembrane domain of the protein FZD6 in individuals of a consanguineous family exhibiting features of nail dysplasia
22249030 When transplanted into immunodeficient mice, neuroblastoma cells expressing the Fzd6 marker grow more aggressively than their Fzd6 negative counterparts. Fzd6 is a new surface marker of aggressive neuroblastoma cells with stem cell-like features.
22211385 The present results emphasize the role of FZD6 mutation in Wnt pathways in nail development.
22078044 Mutations in this gene cause nail dysplasia. Review.
22045688 This study demonstrates that rare nonsynonymous variants in FZD6 may contribute to NTDs in humans and enlarges the spectrum of mutations that link PCP pathway to Neural tube defects (NTDs).
21937024 The current study provides insight into the global changes in gene transcription mediated by chr-ECS and suggests that Fzd6 signaling could represent a novel target for development of novel antidepressants.
21665003 FZD6 mutations can result in severe defects in nail and claw formation through reduced or abolished membranous FZD(6) levels and several nonfunctional WNT-FZD pathways.
19543507 No significant association between C345A or A664C SNPs in the FZD6 gene and bone meineral density at skeletal sites measured or circulating levels of bone turnover markers were noted.
19543507 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19034702 These results suggested that activation of Wnt4/Fzd6 signaling through a "beta-catenin-independent" pathway played a role in proliferation and survival of the pituitary adenoma cells.
14747478 Frizzled 6 (HFz6) has a role as a negative regulator of the canonical Wnt. beta-catenin signaling cascade

AA Sequence

MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECS      1 - 70
PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPH     71 - 140
TEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCL    141 - 210
CATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNK    211 - 280
ACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEG    281 - 350
DNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF    351 - 420
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISA    421 - 490
VFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGT    491 - 560
STGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSG    561 - 630
EQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGG    631 - 700
GCHSDT                                                                    701 - 706
//

Text Mined References (35)

PMID Year Title
25772759 2015 FZD6 expression is negatively regulated by miR-199a-5p in human colorectal cancer.
24816679 2014 Polymorphisms in FZD3 and FZD6 genes and risk of neural tube defects in a northern Han Chinese population.
24657404 2014 Role of Frizzled6 in the molecular mechanism of beta-carotene action in the lung.
24500924 2014 Disheveled regulates precoupling of heterotrimeric G proteins to Frizzled 6.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23748645 2014 Immunoreactivity of Wnt5a, Fzd2, Fzd6, and Ryk in glioblastoma: evaluative methodology for DAB chromogenic immunostaining.
23374899 2013 Recessive mutations in the gene encoding frizzled 6 cause twenty nail dystrophy--expanding the differential diagnosis for pachyonychia congenita.
22861124 2013 A novel missense mutation in the gene FZD6 underlies autosomal recessive nail dysplasia.
22575959 2012 ZNRF3 promotes Wnt receptor turnover in an R-spondin-sensitive manner.
22249030 2011 Frizzled receptor 6 marks rare, highly tumourigenic stem-like cells in mouse and human neuroblastomas.
22211385 2012 FZD6 encoding the Wnt receptor frizzled 6 is mutated in autosomal-recessive nail dysplasia.
22078044 2011 [Of genes and nails].
22045688 2012 FZD6 is a novel gene for human neural tube defects.
21937024 2012 Analysis of target genes regulated by chronic electroconvulsive therapy reveals role for Fzd6 in depression.
21665003 2011 Mutations in Frizzled 6 cause isolated autosomal-recessive nail dysplasia.
19543507 2009 Non-association between polymorphisms of the frizzled receptor genes and bone mineral density in postmenopausal Korean women.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19034702 2008 Expression of Wnt4 in human pituitary adenomas regulates activation of the beta-catenin-independent pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15370539 2004 Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
15265686 2004 Wnt-4 activates the canonical beta-catenin-mediated Wnt pathway and binds Frizzled-6 CRD: functional implications of Wnt/beta-catenin activity in kidney epithelial cells.
14747478 2004 The human Frizzled 6 (HFz6) acts as a negative regulator of the canonical Wnt. beta-catenin signaling cascade.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707601 2001 BAALC, the human member of a novel mammalian neuroectoderm gene lineage, is implicated in hematopoiesis and acute leukemia.
10347172 1999 Interaction of frizzled related protein (FRP) with Wnt ligands and the frizzled receptor suggests alternative mechanisms for FRP inhibition of Wnt signaling.
9480858 1998 Molecular cloning of human Frizzled-6.
8626800 1996 A large family of putative transmembrane receptors homologous to the product of the Drosophila tissue polarity gene frizzled.
1927703 1991 Urinary tract infection in infancy and childhood.