Property Summary

NCBI Gene PubMed Count 16
PubMed Score 23.47
PubTator Score 16.54

Knowledge Summary

Patent (10,344)

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.900 2.1e-02
posterior fossa group A ependymoma 1.300 1.2e-03
atypical teratoid / rhabdoid tumor 2.100 4.1e-02
primitive neuroectodermal tumor 1.300 4.1e-02
non-small cell lung cancer 1.725 6.7e-06
colon cancer 2.600 1.0e-02
lung cancer 5.500 1.8e-07
Breast cancer 2.900 3.2e-02
cystic fibrosis -1.600 1.5e-05
psoriasis -1.100 3.9e-08
spina bifida -1.152 3.6e-02
ovarian cancer 2.400 6.7e-05

 MGI Phenotype (1)

Gene RIF (3)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)
19137009 FZD10 transactivation causes the activation of the Dvl-Rac1-JNK pathway and is associated with the development/progression of synovial sarcomas
19134005 there was a strong inverse correlation between nuclear immunostaining scores for beta-catenin expression and expression patterns of FZD10

AA Sequence

MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHE      1 - 70
FAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNK     71 - 140
NDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPL    141 - 210
CTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIR    211 - 280
LFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAN    281 - 350
SSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL    351 - 420
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTL    421 - 490
DCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKA    491 - 560
QHPQKTHHGKYEIPAQSPTCV                                                     561 - 581
//

Text Mined References (16)

PMID Year Title
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20227380 2010 Development of a bioassay for detection of Wnt-binding affinities for individual frizzled receptors.
20037267 2009 Transcriptional profiling and Wnt signaling activation in proliferation of human hepatic stellate cells induced by PDGF-BB.
19188438 2009 Myocilin is a modulator of Wnt signaling.
19137009 2009 Activation of the non-canonical Dvl-Rac1-JNK pathway by Frizzled homologue 10 in human synovial sarcoma.
19134005 2009 Inverse correlation of the up-regulation of FZD10 expression and the activation of beta-catenin in synchronous colorectal tumors.
18271942 2008 Radioimmunotherapy of human synovial sarcoma using a monoclonal antibody against FZD10.
16007199 2005 Therapeutic potential of antibodies against FZD 10, a cell-surface protein, for synovial sarcomas.
15930302 2005 Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11786918 2002 Frizzled-10, up-regulated in primary colorectal cancer, is a positive regulator of the WNT - beta-catenin - TCF signaling pathway.
11597177 2001 Identification and initial characterization of 5000 expressed sequenced tags (ESTs) each from adult human normal and osteoarthritic cartilage cDNA libraries.
10448064 1999 Molecular cloning of Frizzled-10, a novel member of the Frizzled gene family.
9707618 1998 A novel frizzled gene identified in human esophageal carcinoma mediates APC/beta-catenin signals.