Property Summary

Ligand Count 33
NCBI Gene PubMed Count 446
PubMed Score 1021.21
PubTator Score 672.12

Knowledge Summary

Patent (140,782)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.339 2.2

Expression

  Differential Expression (28)

Disease log2 FC p
astrocytoma 1.100 4.7e-15
Astrocytoma, Pilocytic 1.200 2.7e-05
Chronic Lymphocytic Leukemia -1.178 1.2e-02
cystic fibrosis -1.129 3.8e-05
Down syndrome 1.200 2.0e-03
ductal carcinoma in situ -1.100 1.2e-02
esophageal adenocarcinoma 1.100 2.6e-02
fibroadenoma -1.100 2.9e-02
glioblastoma 1.400 2.2e-05
group 4 medulloblastoma 1.200 4.6e-03
interstitial cystitis 1.300 6.7e-04
intraductal papillary-mucinous neoplasm ... -1.200 1.7e-02
invasive ductal carcinoma -1.300 6.9e-03
juvenile dermatomyositis 1.137 2.6e-08
lung cancer -1.600 2.3e-02
malignant mesothelioma -1.900 1.1e-07
medulloblastoma, large-cell -1.500 1.2e-02
non-small cell lung cancer -1.341 4.4e-14
oligodendroglioma 1.300 2.6e-02
ovarian cancer -1.900 5.0e-05
pancreatic cancer 1.100 1.2e-03
primary pancreatic ductal adenocarcinoma 1.478 1.2e-03
primary Sjogren syndrome 2.200 1.0e-05
psoriasis -1.100 2.1e-03
pulmonary arterial hypertension -3.700 3.6e-02
tuberculosis -1.200 1.0e-04
ulcerative colitis 2.100 9.1e-06
Waldenstrons macroglobulinemia -1.391 1.7e-02

PDB (27)

Gene RIF (176)

AA Sequence

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS      1 - 70
SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP     71 - 140
VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN    141 - 210
GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG    211 - 280
QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSL    281 - 350
LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY    351 - 420
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD    421 - 490
CPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL                           491 - 537
//

Text Mined References (468)

PMID Year Title