Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.56
PubTator Score 15.70

Knowledge Summary

Patent (1,000)

Expression

  Differential Expression (17)

Gene RIF (11)

PMID Text
26302771 FXYD6 was verified to be directly interacting with miR-137..
24715268 FXYD6 plays a critical role of in hepatocellular carcinoma disease progression.
21983730 FXYD6 gene might play an important role in schizophrenia susceptibility.
21216238 these results support that FXYD6 is a susceptibility gene of schizophrenia.
20468077 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20149392 Data show that FXYD6 does not play a role in schizophrenia in the Chinese Han population.
20149392 Observational study of gene-disease association. (HuGE Navigator)
18455306 Our findings suggest that FXYD6 is unlikely to be related to the development of schizophrenia in a Japanese population.
18455306 Observational study of gene-disease association. (HuGE Navigator)
17357072 Observational study of gene-disease association. (HuGE Navigator)
17357072 Base-pair changes in FXYD6 or in associated promoter/control regions are likely to cause abnormal function or expression of phosphohippolin and to increase genetic susceptibility to schizophrenia.

AA Sequence

MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR      1 - 70
APGDEEAQVENLITANATEPQKAEN                                                  71 - 95
//

Text Mined References (25)

PMID Year Title
26302771 2016 MicroRNA-137 is downregulated in human osteosarcoma and regulates cell proliferation and migration through targeting FXYD6.
25416956 2014 A proteome-scale map of the human interactome network.
24715268 2014 FXYD6: a novel therapeutic target toward hepatocellular carcinoma.
21983730 2011 [A family-based association study of FXYD6 gene polymorphisms and schizophrenia].
21216238 2011 A novel replicated association between FXYD6 gene and schizophrenia.
20468077 2010 Failure to confirm genetic association of the FXYD6 gene with schizophrenia: the Japanese population and meta-analysis.
20149392 2010 No association between the FXYD6 gene and schizophrenia in the Chinese Han population.
18455306 2008 A genetic association study of the FXYD domain containing ion transport regulator 6 (FXYD6) gene, encoding phosphohippolin, in susceptibility to schizophrenia in a Japanese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17357072 2007 A genetic association study of chromosome 11q22-24 in two different samples implicates the FXYD6 gene, encoding phosphohippolin, in susceptibility to schizophrenia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10950925 2000 The FXYD gene family of small ion transport regulators or channels: cDNA sequence, protein signature sequence, and expression.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.