Property Summary

NCBI Gene PubMed Count 37
PubMed Score 399.06
PubTator Score 63.15

Knowledge Summary

Patent (14,029)

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis -1.200 4.1e-02
Multiple myeloma 1.537 3.6e-03
osteosarcoma -1.678 4.9e-04
astrocytoma 1.700 2.8e-02
glioblastoma 2.000 2.2e-02
pancreatic ductal adenocarcinoma liver m... 1.999 5.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
lung cancer -1.300 2.3e-03
colon cancer 1.400 1.1e-05
active ulcerative colitis 2.251 4.6e-03
pancreatic cancer 1.600 1.8e-04
pediatric high grade glioma 1.100 9.9e-03
subependymal giant cell astrocytoma 1.729 8.5e-03
spina bifida 1.010 4.1e-02
gastric carcinoma 1.500 2.2e-02
ovarian cancer 1.400 4.0e-05

Gene RIF (28)

PMID Text
26458963 Dysadherin-silenced side population cells exhibited reduced expression of Bcl-2 and Bax compared with that prior to silencing.
26410457 Study demonstrated that the expression of FXYD1, FXYD3 and FXYD5 is elevated in the lungs of Acute respiratory distress syndrome patients
22965940 These results suggest a role of let-7a down-regulation in the development of thyroid neoplasias of the follicular histotype, likely regulating dysadherin protein expression levels.
22494103 Findings suggest that dysadherin might contribute to breast cancer progression through AKT activation.
22105147 we are focusing on the role of dysadherin in E-cadherin downregulation, the various expression patterns of the molecule in head and neck cancer
21809991 Overexpression of Snail, Slug, and dysadherin and activation of Wnt and PI3K/Akt signaling was associated with inactivated E-cadherin in the spindle cells of monophasic fibrous synovial sarcomas.
21774927 This is the first report on expression of dysadherin in the male gonad and in spermatozoa.
21328336 Data show that osteoblasts are the major cell type of the bone marrow that affect RCC cells by secreting factors that increase the expression of dysadherin and CCL2 in the tumor cells leading to enhanced cell migration.
21239043 Combined dysadherin-positive expression and E-cadherin-negative expression may be valuable information for predicting aggressive tumor behavior of differentiated-type gastric carcinoma with submucosal invasion
20952084 transfection of dysadherin cDNA into the liver cancer cell line PLC/PRF/5 enhanced the properties of cencer stem cells, including anti-apoptosis, their sphere-forming ability, side population phenotype, and tumor initiation ability in vivo
20944097 The detection of dysadherin in tumors and cytokeratin in the lymph nodes may be a potential significant indicator of a poor prognosis for patients who undergo complete resection of stage I non-small cell lung cancer
20712010 In lung carcinomas dysadherin expression seems to reflect tumour aggressiveness and may be considered a positive marker of poor prognosis when considered alone or/and in combination with down-regulation of E-cadherin.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19217217 The dysadherin expression level was significantly correlated with gastrointestinal stromal tumor risk stratification.
18677652 Increased dysadherin expression is possibly one of the post-transcriptional mechanisms responsible for E-cadherin downregulation in thyroid papillary neoplasia
18263667 FXYD5 is upregulated in cystic fibrosis epithelia which may exacerbate the Na(+) hyperabsorption and surface liquid dehydration observed in cystic fibrosis.
17442482 Recent work that has provided insights into possible mechanisms of action of dysadherin in the cancer progression process was reviewed.
17437014 Dysadherin may play an important role in breast cancer progression by promoting invasion.
17084448 Found in trophoblasts in both normal and abnormal pregnancies.
16333245 In testicular tumours, as in other neoplasms, dysadherin downregulates E-cadherin expression, at least in part
15751018 Over expression of dysadherin is associated with cutaneous malignant melanoma
15619642 dysadherin may be a valuable prognostic marker in cervical carcinoma.
15466191 Dysadherin is able to modulate actin structures, stimulate cell motility, and contribute directly to the metastatic potential of human pancreatic cancer cells.
15459499 Dysadherin and E-cadherin expression may help to predict the prognosis of patients with ESCC (esophageal squamous cell carcinoma).
15102690 dysadherin has a role in hematogenous metastasis of gastric cancer
12970317 dysadherin expression was significantly associated with the prognosis, occurrence of secondary undifferentiated carcinomas, size of the primary tumor, and metastasis to the regional lymph nodes and lungs
11756660 We report the cloning and characterization of a cancer-associated cell membrane glycoprotein recognized by mAb NCC-3G10.

AA Sequence

MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQ      1 - 70
PQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEH     71 - 140
TLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR                                    141 - 178
//

Text Mined References (38)

PMID Year Title
26458963 2015 Aberrantly regulated dysadherin and B-cell lymphoma 2/B-cell lymphoma 2-associated X enhances tumorigenesis and DNA targeting drug resistance of liver cancer stem cells.
26410457 2016 FXYD1 negatively regulates Na(+)/K(+)-ATPase activity in lung alveolar epithelial cells.
24717576 2014 Modulation of cell polarization by the Na+-K+-ATPase-associated protein FXYD5 (dysadherin).
22965940 2012 Let-7a down-regulation plays a role in thyroid neoplasias of follicular histotype affecting cell adhesion and migration through its ability to target the FXYD5 (Dysadherin) gene.
22494103 2012 Dysadherin expression promotes the motility and survival of human breast cancer cells by AKT activation.
22105147 2012 Role of the recently identified dysadherin in E-cadherin adhesion molecule downregulation in head and neck cancer.
21809991 2011 Immunohistochemical study of correlation between histologic subtype and expression of epithelial-mesenchymal transition-related proteins in synovial sarcomas.
21774927 2011 Expression of dysadherin in the human male reproductive tract and in spermatozoa.
21328336 2012 Osteoblast-secreted factors enhance the expression of dysadherin and CCL2-dependent migration of renal carcinoma cells.
21239043 2011 Significance of dysadherin and E-cadherin expression in differentiated-type gastric carcinoma with submucosal invasion.
20952084 2011 Dysadherin can enhance tumorigenesis by conferring properties of stem-like cells to hepatocellular carcinoma cells.
20944097 2010 Expression of dysadherin and cytokeratin as prognostic indicators of disease-free survival in patients with stage I NSCLC.
20712010 2010 Comparison of the dysadherin and E-cadherin expression in primary lung cancer and metastatic sites.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19217217 2009 Dysadherin expression in gastrointestinal stromal tumors (GISTs).
18677652 2008 Differential expression of dysadherin in papillary thyroid carcinoma and microcarcinoma: correlation with E-cadherin.
18263667 2008 FXYD5 modulates Na+ absorption and is increased in cystic fibrosis airway epithelia.
17442482 2007 Dysadherin: a new player in cancer progression.
17437014 2007 In breast carcinoma dysadherin expression is correlated with invasiveness but not with E-cadherin.
17084448 Expression of dysadherin and E-cadherin in trophoblastic tissue in normal and abnormal pregnancies.
16341674 2005 Transcriptome analysis of human gastric cancer.
16333245 2005 Involvement of dysadherin and E-cadherin in the development of testicular tumours.
15751018 2005 Clinicopathologic significance of dysadherin expression in cutaneous malignant melanoma: immunohistochemical analysis of 115 patients.
15619642 2004 Prognostic significance of dysadherin expression in cervical squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466191 2004 Dysadherin expression facilitates cell motility and metastatic potential of human pancreatic cancer cells.
15459499 2004 Prognostic significance of dysadherin expression in esophageal squamous cell carcinoma.
15102690 2004 Clinical significance of dysadherin expression in gastric cancer patients.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12970317 2003 Dysadherin: expression and clinical significance in thyroid carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756660 2002 Dysadherin, a cancer-associated cell membrane glycoprotein, down-regulates E-cadherin and promotes metastasis.
11342114 2001 A cDNA from human bone marrow encoding a protein exhibiting homology to the ATP1gamma1/PLM/MAT8 family of transmembrane proteins.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10950925 2000 The FXYD gene family of small ion transport regulators or channels: cDNA sequence, protein signature sequence, and expression.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.