Property Summary

NCBI Gene PubMed Count 26
PubMed Score 51.13
PubTator Score 31.15

Knowledge Summary

Patent (9,225)

Expression

  Differential Expression (15)

Gene RIF (17)

PMID Text
26740212 Suppression of FXYD3 in MCF-7.
26410457 Study demonstrated that the expression of FXYD1, FXYD3 and FXYD5 is elevated in the lungs of Acute respiratory distress syndrome patients
22430872 All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis.
20805335 ExoS facilitates P. aeruginosa penetration through the intestinal epithelial barrier by binding to FXYD3 and thereby impairing the defense function of tight junctions against bacterial penetration.
20364041 Up-regulated expression of FXYD-3 protein may be involved in tumourgenesis and invasion of gastric adenocarcinoma.
20112499 Upregulation of FXYD3 is associated with glioma.
19955746 FXYD3 expression is related to several biological variables including ras, p53, legumain and PCNA, and may be involved in the development of the relatively early stages of colorectal cancers
19893046 inactivation of FXYD3 through a gene mutation or unknown mechanism could be one cause of the atypical shapes of cancer cells and play a potential role in the progression of lung cancer.
19571376 FXYD3a protein is highly expressed in breast cancers, and responsible for cancer cell proliferation.
19109419 FXYD3 silencing prevents proper regulation of Na,K-ATPase, which leads to perturbation of cellular Na+ and K+ homeostasis and changes in the expression of Na,K-ATPase isozymes, whose functional properties are incompatible with cell differentiation.
18000745 structures of the FXYD proteins (with emphasis on 1-4), as well as their dynamics and their associations with the lipid
17409496 FXYD3 interacts with Na(+)-K(+)-Exchanging ATPase in colorectal neoplasms.
17077088 analysis of two human FXYD3 isoforms that are differentially expressed in differentiated and non-differentiated cells with different functional properties
16288923 show that the helical regions and connecting segments of FXYD1, FXYD3, and FXYD4 determined in micelles by NMR spectroscopy coincide with the positions of intron-exon junctions in the genes
16003754 overexpression of FXYD3 in pancreatic cancer may contribute to the proliferative activity of this malignancy
14654946 Results indicate that the human MAT-8 gene contains the potential to serve as a prostate cancer expression marker and that MAT-8 plays an important role in cellular growth of prostate carcinomas.
12535606 molecular cloning, protein expression, sequencing and NMR structure determination

AA Sequence

MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG      1 - 70
HHPGETPPLITPGSAQS                                                          71 - 87
//

Text Mined References (27)

PMID Year Title
26740212 2016 Silencing overexpression of FXYD3 protein in breast cancer cells amplifies effects of doxorubicin and ?-radiation on Na(+)/K(+)-ATPase and cell survival.
26410457 2016 FXYD1 negatively regulates Na(+)/K(+)-ATPase activity in lung alveolar epithelial cells.
22430872 2012 Tissue-based proteomics reveals FXYD3, S100A11 and GSTM3 as novel markers for regional lymph node metastasis in colon cancer.
20805335 2010 Translocation of Pseudomonas aeruginosa from the intestinal tract is mediated by the binding of ExoS to an Na,K-ATPase regulator, FXYD3.
20364041 2010 Expression and significance of FXYD-3 protein in gastric adenocarcinoma.
20112499 2009 FXYD3 expression in gliomas and its clinicopathological significance.
19955746 2009 Expression of FXYD3 protein in relation to biological and clinicopathological variables in colorectal cancers.
19893046 2009 Down-regulation of FXYD3 expression in human lung cancers: its mechanism and potential role in carcinogenesis.
19571376 2009 FXYD3 protein involved in tumor cell proliferation is overproduced in human breast cancer tissues.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19109419 2009 A link between FXYD3 (Mat-8)-mediated Na,K-ATPase regulation and differentiation of Caco-2 intestinal epithelial cells.
18000745 2007 Structures of the FXYD regulatory proteins in lipid micelles and membranes.
17409496 2007 Interaction of Mat-8 (FXYD-3) with Na+/K+-ATPase in colorectal cancer cells.
17077088 2006 Structural and functional properties of two human FXYD3 (Mat-8) isoforms.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16288923 2005 Correlation of gene and protein structures in the FXYD family proteins.
16003754 2006 FXYD3 is overexpressed in pancreatic ductal adenocarcinoma and influences pancreatic cancer cell growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14654946 2004 Up-regulated expression of the MAT-8 gene in prostate cancer and its siRNA-mediated inhibition of expression induces a decrease in proliferation of human prostate carcinoma cells.
12535606 2003 Expression and characterization of the FXYD ion transport regulators for NMR structural studies in lipid micelles and lipid bilayers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10950925 2000 The FXYD gene family of small ion transport regulators or channels: cDNA sequence, protein signature sequence, and expression.
8521420 1995 Identification of melanoma inhibitory activity and other differentially expressed messenger RNAs in human melanoma cell lines with different metastatic capacity by messenger RNA differential display.
7836447 1995 Mat-8, a novel phospholemman-like protein expressed in human breast tumors, induces a chloride conductance in Xenopus oocytes.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.