Property Summary

NCBI Gene PubMed Count 33
PubMed Score 23.86
PubTator Score 30.67

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Gene RIF (15)

PMID Text
25765846 Recurrent FXYD2 p.Gly41Arg mutation is associated with isolated dominant hypomagnesaemia.
24794573 FXYD2b could regulate the Na,K-ATPase by modulating the effective membrane surface electrostatics near the ion binding sites of the pump.
24258619 our findings suggested that FXYD2c played a role in regulation of NKA activity by enhancing the expression of NKA in HK-2 cells upon hypertonic challenge.
24204001 PCBD1 (dimerization cofactor of HNF-1alpha) is coactivator of the HNF1B-mediated transcription necessary for fine tuning ATPase Na+/K+ transporting gamma 1 polypeptide (FXYD2) transcription in the distal convoluted tubule.
23196795 This is the first report demonstrating the potential utility of FXYD2 immunohistochemistry in the diagnosis of chromophobe renal cell carcinoma
22588134 findings confirm the presence of an FXYD2 peptide in the crab gill Na,K-ATPase and demonstrate that this peptide plays an important role in regulating enzyme activity
21130072 wild type HNF1B specifically induces FXYD2A transcription whereas all HNF1B mutants partially prevented it.
20379810 Datab propose human FXYD2gammaa as a novel beta cell-specific biomarker.
19879113 Study reveals, in various human tissues, the specific expression of FXYD2, which may associate with Na, K-ATPase in selected cell types and modulate its catalytic properties.
19865785 Data conclude that human proximal tubular cells respond to a hyperosmotic challenge with an increase in FXYD2 and Na,K-ATPase protein expression, though to a smaller absolute extent in patient cells.
18448590 results suggest that FXYD2 can mediate basolateral extrusion of magnesium from cultured renal epithelial cells and provide new insights into the understanding of the possible physiological roles of FXYD2 wild-type and mutant proteins.
18000745 structures of the FXYD proteins (with emphasis on 1-4), as well as their dynamics and their associations with the lipid
17316900 Activity of GLAST directs FXYD2 protein/gamma subunit to the cell surface, that leads to the activation of the astroglial sodium pump.
12907667 the TM domain of FYXD2 effects the shift in apparent Na+ affinity
10559186 Expression in transfectants reduces Na+ and K+ affinity of Na,K-ATPase. Endogenous expression in certain nephron segments correlates with low Na+ affinity in Na,K-ATPase.

AA Sequence

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP          1 - 66
//

Text Mined References (33)

PMID Year Title
25765846 2015 Recurrent FXYD2 p.Gly41Arg mutation in patients with isolated dominant hypomagnesaemia.
24794573 2015 Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: implications for membrane-water interfacial arginines.
24258619 2014 FXYD2c plays a potential role in modulating Na(+)/K (+)-ATPase activity in HK-2 cells upon hypertonic challenge.
24204001 2014 Mutations in PCBD1 cause hypomagnesemia and renal magnesium wasting.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23196795 2013 Expression of the Na+/K+-transporting ATPase gamma subunit FXYD2 in renal tumors.
22588134 2012 Identification of a crab gill FXYD2 protein and regulation of crab microsomal Na,K-ATPase activity by mammalian FXYD2 peptide.
21130072 2011 HNF-1B specifically regulates the transcription of the ?a-subunit of the Na+/K+-ATPase.
20379810 2010 A genomic-based approach identifies FXYD domain containing ion transport regulator 2 (FXYD2)gammaa as a pancreatic beta cell-specific biomarker.
19879113 2010 Differential cellular expression of FXYD1 (phospholemman) and FXYD2 (gamma subunit of Na, K-ATPase) in normal human tissues: a study using high density human tissue microarrays.
19865785 2009 FXYD2 and Na,K-ATPase expression in isolated human proximal tubular cells: disturbed upregulation on renal hypomagnesemia?
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18448590 2008 Human FXYD2 G41R mutation responsible for renal hypomagnesemia behaves as an inward-rectifying cation channel.
18000745 2007 Structures of the FXYD regulatory proteins in lipid micelles and membranes.
17316900 2007 Glutamate transporter GLAST/EAAT1 directs cell surface expression of FXYD2/gamma subunit of Na, K-ATPase in human fetal astrocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15071553 2004 Biology, structure and mechanism of P-type ATPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12907667 2003 Modulation of Na,K-ATPase by the gamma subunit: studies with transfected cells and transmembrane mimetic peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11832419 2002 Distribution and oligomeric association of splice forms of Na(+)-K(+)-ATPase regulatory gamma-subunit in rat kidney.
11112438 2000 Genomic organization of the human FXYD2 gene encoding the gamma subunit of the Na,K-ATPase.
11062458 2000 Dominant isolated renal magnesium loss is caused by misrouting of the Na(+),K(+)-ATPase gamma-subunit.
10950925 2000 The FXYD gene family of small ion transport regulators or channels: cDNA sequence, protein signature sequence, and expression.
10559186 1999 The gamma subunit modulates Na(+) and K(+) affinity of the renal Na,K-ATPase.
9915957 1999 Hereditary isolated renal magnesium loss maps to chromosome 11q23.
9600999 1998 The gamma subunit of the Na,K-ATPase induces cation channel activity.
9463334 1998 The gene for glycogen-storage disease type 1b maps to chromosome 11q23.
9405479 1997 Tissue-specific distribution and modulatory role of the gamma subunit of the Na,K-ATPase.
9048881 1997 Cloning and expression of human cDNA encoding Na+, K(+)-ATPase gamma-subunit.
7916648 1993 Isolation of kidney complementary DNAs down-expressed in Wilms' tumor by a subtractive hybridization approach.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.