Property Summary

NCBI Gene PubMed Count 53
PubMed Score 47.18
PubTator Score 36.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.823 1.3e-03
Multiple myeloma 2.053 2.4e-04
osteosarcoma 2.341 2.1e-06
posterior fossa group B ependymoma -1.400 4.3e-09
glioblastoma -1.400 7.9e-06
atypical teratoid / rhabdoid tumor -1.400 5.0e-08
medulloblastoma, large-cell -1.200 5.7e-04
tuberculosis and treatment for 6 months -1.500 1.5e-06
primary pancreatic ductal adenocarcinoma -1.054 9.5e-03
non-small cell lung cancer 1.500 5.6e-20
intraductal papillary-mucinous neoplasm ... -1.700 8.8e-04
lung cancer 1.400 2.1e-03
Breast cancer 2.400 4.3e-02
adult high grade glioma -1.500 2.5e-04
non primary Sjogren syndrome sicca -1.100 2.6e-02
nasopharyngeal carcinoma 1.100 9.0e-04
lung adenocarcinoma 1.190 2.7e-04
ovarian cancer 2.600 2.6e-06
Gaucher disease type 1 -1.600 1.2e-02
pituitary cancer 1.500 7.4e-05

Gene RIF (19)

PMID Text
26942679 P97 interacts with 3' UTR-binding FXR1a-associated microRNPs and with PARN, which binds mRNA 5' caps, forming a specialized complex to translate recruited mRNAs in these altered canonical translation conditions.
26612855 An accumulation of 8 SNPs in the fragile gene family (FMR1, FXR1 and FXR2)were found associated with autistic traits in a sample of male patients.
26240334 FXR1P is a GSK3beta substrate with a role in regulating mood and emotion processing
25733852 The mechanisms by which FXR1 executes its regulatory function by forming a novel complex with two other oncogenes, protein kinase C, iota and epithelial cell transforming 2, located in the same amplicon via distinct binding mechanisms, were identified.
25496916 Fragile X mental retardation, autosomal homolog 1 (FXR1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25225333 binding of PKP1/3 to FXR1 was RNA independent, and both PKP3 and FXR1 stabilized PKP2 mRNA.
25010285 Fragile X mental retardation, autosomal homolog 1 (FXR1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24389646 findings showed that FXR1P interacts with BTF in vivo and proved that FXR1P and BTF can co-localize mainly in the cytoplasm around the nucleus
24108105 Deregulation of Fragile X-related protein 1 by the lipodystrophic lamin A p.R482W mutation elicits a myogenic gene expression program in preadipocytes.
23881279 FXR1 and UPF1 may have a functional role in prostate cancer progression and metastasis.
23555284 Our study describes a novel role of FXR1P that has crucial implications for the understanding of its role during myogenesis and muscle development
21072162 Data show that the nuclear localization signals of the FXR1 and FXR2 comprise tandem Tudor domain architectures.
20442204 These results indicate that FMR1 gene function is evolutionarily conserved in neural mechanisms and cannot be compensated by either FXR1 or FXR2, but that all three proteins can substitute for each other in non-neuronal requirements.
19487368 FXR1P and FXR2P KH2 domains bind G-quadruplex and kissing complex RNA with the same affinity as the FMRP KH2 domain.
18854154 Knockdown of fragile X mental retardation, autosomal homolog 1 (FXR1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18628314 FXR1 mRNA splicing pattern is altered in facioscapulohumeral muscular dystrophy myoblasts.
17382880 A crosslinking-coupled affinity purification method was used to isolate TNF-alpha AU-rich element-associated proteins: two microRNP-related proteins, FXR1 and AGO2 were found that associate during translation activation.
17290396 Results show that three genes, namely FXR1, CLAPM1 and EIF4G, are most frequently overexpressed in the center of the amplified domain in squamous cell carcinomas.
15968590 Fxr1p shows a more tissue-specific expression particularly during late embryonic development.

AA Sequence

MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSR      1 - 70
ANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREA     71 - 140
CANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLE    141 - 210
CTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLE    211 - 280
FVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL    281 - 350
LEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS    351 - 420
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTAD    421 - 490
TDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADYISRAESQSRQRNLPRETLAK    491 - 560
NKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGEEKINTLKEENTQEAAVLNGVS             561 - 621
//

Text Mined References (66)

PMID Year Title
26942679 2016 A Specialized Mechanism of Translation Mediated by FXR1a-Associated MicroRNP in Cellular Quiescence.
26612855 2015 Accumulated common variants in the broader fragile X gene family modulate autistic phenotypes.
26240334 2015 FXR1P is a GSK3? substrate regulating mood and emotion processing.
25800735 2015 SplicePie: a novel analytical approach for the detection of alternative, non-sequential and recursive splicing.
25733852 2015 The RNA binding protein FXR1 is a new driver in the 3q26-29 amplicon and predicts poor prognosis in human cancers.
25225333 2014 Plakophilins 1 and 3 bind to FXR1 and thereby influence the mRNA stability of desmosomal proteins.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24389646 2014 Bcl-2-associated transcription factor 1 interacts with fragile X-related protein 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24108105 2014 Deregulation of Fragile X-related protein 1 by the lipodystrophic lamin A p.R482W mutation elicits a myogenic gene expression program in preadipocytes.
23974796 2013 Identification of a long non-coding RNA-associated RNP complex regulating metastasis at the translational step.
23881279 2013 Plakophilin-associated RNA-binding proteins in prostate cancer and their implications in tumor progression and metastasis.
23555284 2013 A novel role for the RNA-binding protein FXR1P in myoblasts cell-cycle progression by modulating p21/Cdkn1a/Cip1/Waf1 mRNA stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21072162 2010 Structural studies of the tandem Tudor domains of fragile X mental retardation related proteins FXR1 and FXR2.
20442204 Fragile X mental retardation protein has a unique, evolutionarily conserved neuronal function not shared with FXR1P or FXR2P.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19571811 2009 Common polygenic variation contributes to risk of schizophrenia and bipolar disorder.
19487368 2009 Discrimination of common and unique RNA-binding activities among Fragile X mental retardation protein paralogs.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18664458 2008 Tdrd3 is a novel stress granule-associated protein interacting with the Fragile-X syndrome protein FMRP.
18628314 2008 Alteration of expression of muscle specific isoforms of the fragile X related protein 1 (FXR1P) in facioscapulohumeral muscular dystrophy patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17382880 2007 AU-rich-element-mediated upregulation of translation by FXR1 and Argonaute 2.
17290396 2007 Frequent overexpression of the genes FXR1, CLAPM1 and EIF4G located on amplicon 3q26-27 in squamous cell carcinoma of the lung.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17057366 2006 Dicer-derived microRNAs are utilized by the fragile X mental retardation protein for assembly on target RNAs.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16571602 2006 The nuclear microspherule protein 58 is a novel RNA-binding protein that interacts with fragile X mental retardation protein in polyribosomal mRNPs from neurons.
16381901 2006 The LIFEdb database in 2006.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15968590 2005 Two members of the Fxr gene family, Fmr1 and Fxr1, are differentially expressed in Xenopus tropicalis.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380484 2004 Transport kinetics of FMRP containing the I304N mutation of severe fragile X syndrome in neurites of living rat PC12 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532325 2003 Fragile X Mental Retardation protein determinants required for its association with polyribosomal mRNPs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11735223 2001 Comparative genomic sequence analysis of the FXR gene family: FMR1, FXR1, and FXR2.
11438699 2001 A highly conserved protein family interacting with the fragile X mental retardation protein (FMRP) and displaying selective interactions with FMRP-related proteins FXR1P and FXR2P.
11157796 2001 Evidence that fragile X mental retardation protein is a negative regulator of translation.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10888599 2000 The fragile X-related proteins FXR1P and FXR2P contain a functional nucleolar-targeting signal equivalent to the HIV-1 regulatory proteins.
10567518 1999 Isolation of an FMRP-associated messenger ribonucleoprotein particle and identification of nucleolin and the fragile X-related proteins as components of the complex.
10556305 1999 A novel RNA-binding nuclear protein that interacts with the fragile X mental retardation (FMR1) protein.
10527928 1999 Oligomerization properties of fragile-X mental-retardation protein (FMRP) and the fragile-X-related proteins FXR1P and FXR2P.
10196376 1999 Different targets for the fragile X-related proteins revealed by their distinct nuclear localizations.
9817930 1998 Novel isoforms of the fragile X related protein FXR1P are expressed during myogenesis.
9642279 1998 The fragile-X-related gene FXR1 is a human autoantigen processed during apoptosis.
9259278 1997 Differential expression of FMR1, FXR1 and FXR2 proteins in human brain and testis.
8668200 1996 Specific sequences in the fragile X syndrome protein FMR1 and the FXR proteins mediate their binding to 60S ribosomal subunits and the interactions among them.
8634689 1995 Highly conserved 3' UTR and expression pattern of FXR1 points to a divergent gene regulation of FXR1 and FMR1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7781595 1995 FXR1, an autosomal homolog of the fragile X mental retardation gene.
7489725 1995 The fragile X mental retardation syndrome protein interacts with novel homologs FXR1 and FXR2.