Property Summary

NCBI Gene PubMed Count 174
PubMed Score 1114.82
PubTator Score 825.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Friedreich ataxia 24 9.247 4.0
FRIEDREICH ATAXIA 1 1 0.0 0.0

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.9e-04
lung cancer 1.100 2.2e-03
medulloblastoma, large-cell 1.100 6.8e-04
osteosarcoma -1.034 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.423 1.2e-03
tuberculosis 1.200 2.3e-06

PDB (12)

Gene RIF (147)

AA Sequence

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK      1 - 70
QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL     71 - 140
GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA    141 - 210
//

Text Mined References (177)

PMID Year Title