Property Summary

NCBI Gene PubMed Count 30
PubMed Score 78.87
PubTator Score 124.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.9e-05
glioblastoma -1.100 3.7e-05
medulloblastoma, large-cell -1.100 1.4e-03
juvenile dermatomyositis -1.060 3.8e-08
Amyotrophic Lateral Sclerosis -1.095 2.5e-04
ovarian cancer -1.200 1.7e-05
psoriasis 1.600 1.9e-32

Gene RIF (15)

PMID Text
24176542 This study presents the first example of a distinct regulatory mechanism involving transcriptional down-regulation of Fut7 by MAPCs that could modulate the trafficking behavior of T cells in vivo.
21197561 After transfection of JAR cells with fucosyltransferase VII, the expression of FUT7 and sLeX synthesis were increased, and the percent adhesion of trophoblast cells to RL95-2 cell monolayer was significantly increased.
20428816 Overexpression of alpha1,3 FucT-VII promoted the expression of CD24 and SLe X and is associated with colorectal carcinoma metastases.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18452157 This is the first time to report that alpha1,3FucT-VII can regulate the mRNA expression of integrin.
18402946 Overexpression of fucosyltransferase VII (FUT7) promotes embryo adhesion and implantation.
17760744 Observational study of gene-disease association. (HuGE Navigator)
17436081 The up regulation of alpha1,3FucT-VII mRNA and cell surface SLe(x) (alpha1,3FucT-VII product) by UV and down regulation of them by ATRA was speculated to be one of the mechanisms that alpha1,3FucT-VII decreased and increased [susceptibility to] apoptosis.
17229154 Alpha 1,3-fucosyltransferase-VII regulates the signaling molecules of the insulin receptor pathway
15926890 A differential functional impact of N-glycosylation on C2GnT-1 and FucT-VII and disclose that a strongly reduced FucT-VII activity retains the ability to fucosylate PSGL-1 on the core2-based binding site(s) for the three selectins.
15579466 human FucT-IV and -VII both contribute and cooperate in regulating L-selectin-, P-selectin-, and E-selectin-dependent rolling on PSGL-1, with FucT-VII playing a predominant role in conferring selectin binding activity to PSGL-1
15464988 These results suggest that the FucT-VII may be a major regulator of the biosynthesis of the sLe(x)-epitopes on T lymphoblasts.
15262995 H-Ras mediates FucT-VII induction in Jurkat T cells via the activation of the Raf, PI3K, and a distinct, H-Ras-specific effector signaling pathway.
12506041 The Fuc-T VII promoter is transactivated by Tax in concert with CBP through a CRE-like sequence in a manner similar to that of viral CRE in HTLV-1 LTR.

AA Sequence

MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQPPELPSDTCTR      1 - 70
YGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWASMESPSHTHGLSHLRGIFNWV     71 - 140
LSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVDVFGRANGRPL    141 - 210
CASCLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSA    211 - 280
RELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA            281 - 342
//

Text Mined References (31)

PMID Year Title
24176542 2014 Human multipotent adult progenitor cells transcriptionally regulate fucosyltransferase VII.
21197561 2011 sLeX/L-selectin mediates adhesion in vitro implantation model.
20428816 2010 Alpha1,3 fucosyltransferase VII plays a role in colorectal carcinoma metastases by promoting the carbohydration of glycoprotein CD24.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19946888 2010 Defining the membrane proteome of NK cells.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18452157 2008 alpha1,3 fucosyltransferase-VII up-regulates the mRNA of alpha5 integrin and its biological function.
18402946 2009 Overexpression of fucosyltransferase VII (FUT7) promotes embryo adhesion and implantation.
17760744 2007 Evaluation of urinary CA19-9 levels in bladder cancer patients classified according to the combinations of Lewis and Secretor blood group genotypes.
17436081 2007 Alpha1,3 Fucosyltransferase-VII modifies the susceptibility of apoptosis induced by ultraviolet and retinoic acid in human hepatocarcinoma cells.
17229154 2007 Alpha 1,3-fucosyltransferase-VII regulates the signaling molecules of the insulin receptor pathway.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
15926890 2005 N-glycans of core2 beta(1,6)-N-acetylglucosaminyltransferase-I (C2GnT-I) but not those of alpha(1,3)-fucosyltransferase-VII (FucT-VII) are required for the synthesis of functional P-selectin glycoprotein ligand-1 (PSGL-1): effects on P-, L- and E-selectin binding.
15579466 2005 Regulation of PSGL-1 interactions with L-selectin, P-selectin, and E-selectin: role of human fucosyltransferase-IV and -VII.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464988 2004 Highly sensitive cell-based assay system to monitor the sialyl Lewis X biosynthesis mediated by alpha1-3 fucosyltransferase-VII.
15262995 2004 H-Ras and phosphoinositide 3-kinase cooperate to induce alpha(1,3)-fucosyltransferase VII expression in Jurkat T cells.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12506041 2003 Transactivation of the fucosyltransferase VII gene by human T-cell leukemia virus type 1 Tax through a variant cAMP-responsive element.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11825883 2002 The cytosolic and transmembrane domains of the beta 1,6 N-acetylglucosaminyltransferase (C2GnT) function as a cis to medial/Golgi-targeting determinant.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11425803 2001 Neighboring cysteine residues in human fucosyltransferase VII are engaged in disulfide bridges, forming small loop structures.
11404359 2001 Identification of a missense mutation (G329A;Arg(110)--> GLN) in the human FUT7 gene.
9592127 1998 Fucosyltransferase activities in human pancreatic tissue: comparative study between cancer tissues and established tumoral cell lines.
9147044 1997 Developmental regulation of alpha 1,3-fucosyltransferase expression in CD34 positive progenitors and maturing myeloid cells isolated from normal human bone marrow.
8626519 1996 Expression of the alpha(1,3)fucosyltransferase Fuc-TVII in lymphoid aggregate high endothelial venules correlates with expression of L-selectin ligands.
8207002 1994 Molecular cloning of a cDNA encoding a novel human leukocyte alpha-1,3-fucosyltransferase capable of synthesizing the sialyl Lewis x determinant.
8182079 1994 Expression cloning of a novel alpha 1,3-fucosyltransferase that is involved in biosynthesis of the sialyl Lewis x carbohydrate determinants in leukocytes.
8051184 1994 Molecular cloning of a cDNA encoding a novel human leukocyte alpha-1,3-fucosyltransferase capable of synthesizing the sialyl Lewis x determinant.