Property Summary

NCBI Gene PubMed Count 65
PubMed Score 1189.46
PubTator Score 865.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (50)

PMID Text
26701615 Our results indicate that FUT4 and miR-224-3p are crucial regulators of cancer response to chemotherapy, and may serve as therapeutic targets to reverse chemotherapy resistance in breast cancer.
26427914 Cancer-related CD15/FUT4 overexpression participates in cetuximab or bevacizumab mechanisms of resistance in metastatic colorectal cancer patients.
26427350 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions
26418972 the acquisition of a sialyl moiety by the CD15 antigen may precede the widespread dissemination in Hodgkin lymphoma.
26290260 A subset of choroidal and ciliary body melanomas overexpress the CD15 antigen.
25896022 This study suggests that baicalin facilitates endometrial reproduction via elevating FUT4 expression through Wnt/beta-catenin signaling pathway
25869074 This provides an automated procedure, which shortens the mentally tiring and time-consuming process of microscopic cell counting and thus makes a contribution towards the standardization of tools for diagnosing PJI.
25776515 A significant high expression of FUT4 in breast cancer tissues and serum was found compared to controls.
25697377 Data suggest that changes in DNA methylation in trophoblasts regulate (1) cell mobility/placentation, (2) expression of claudin-4 (CLDN4) and 4-fucosyltransferase (FUT4), and (3) matrix metalloproteinase (MMP2 and MMP9) activity.
25608813 The lower expression of FUT4 in HaCaT cells is correlated with the methylation of CpG island in FUT4 promoter.
25149387 level of expression in the macro- and microvasculature reflects the degree of pathological placental villous immaturity
25121780 Titration of the monomeric DC-SIGN CRD with Le(X) monitored by 2D NMR revealed significant perturbations of DC-SIGN cross-peak positions in (1)H-(15)N heteronuclear single quantum coherence (HSQC) spectra and identified residues near the binding site.
25043745 Physiologically immature placentas and pathologically immature term placentas were characterized by marked endothelial CD15-immunostaining. Significant loss of CD15-positive endothelium was associated with physiological and accelerated villous maturity.
24425323 The correlation of sLex overexpression in primary tumors and metastatic lymph nodes, the discrimination among the normal, adenoma, and CRC groups based on sLex expression.
24232099 Results suggest that FUT4-, FUT6- or FUT8-mediated MDR in human HCC is associated with the activation of the PI3K/Akt pathway and the expression of MRP1.
24171785 MMP-2 and sLe(x) were negative prognostic markers for survival in these head and neck squamous cell carcinoma patients.
24086629 AQP9 expressing glioma cells were negative for the brain tumor stem cell marker CD15.
23959823 FUT4 is a target gene for HSF1 and Sp1 that is required for cell cycle progression in breast cancer epithelial cells.HSF1 and Sp1 regulate FUT4 gene expression and cell proliferation in breast cancer cells.
23799130 The expression of ST3GAL4 leads to SLe(x) antigen expression in gastric cancer cells which in turn induces an increased invasive phenotype through the activation of c-Met
23681114 Lewis x appeared to be a new, reliable marker that can be used to clearly distinguish invasive hydatidiform moles from choriocarcinomas.
22691873 TNF increases the expression of alpha2,3-sialyltransferase gene ST3GAL4
22411914 High CD15 expression is associated with medulloblastoma.
22287018 FUT4 expression is negatively correlated with the methylation degree of a CpG island in the FUT4 promoter.
22145955 the expression of Lewis Y and FUT4 correlates with endometrial receptivity
22084431 Resting natural killer (NK) cells that have been coincubated with NK-resistant CD15-positive tumor cells lyse Raji cells and are capable of lysing a variety of NK-resistant tumor cells of different lineages.
21931765 MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma
21857669 Data show that tumours induced by transformed fibroblasts are hierarchically organized, and the cells that act as CSCs to initiate and maintain tumour growth are marked by the stage-specific embryonic antigen SSEA-1.
21635204 Data indicate that among MDS cases, CD15+ and CD19+ cell TLs were positively correlated, and PBL TL was was not associated with hTERT genotype.
21521691 NEU4 plays an important role in control of sialyl Lewis antigen expression and its impairment in colon cancer
21457163 CD15-expressing nodular lymphocyte-predominant Hodgkin lymphoma
21337384 FUT4 inhibited cell apoptosis through decreasing the expression of apoptotic proteins and increasing the expression of anti-apoptotic protein Bcl-2
20965272 The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach.
20605574 In endometrial tissues, knockdown of FUT4 expression reduces expression of Lewis Y antigen but not of integrin alphavbeta3.
20506505 These studies suggest that FUT4 regulates A431 cell growth through controlling cell cycle progression via MAPK and PI3K/Akt signaling pathways.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and that the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20181261 CD133, CD15/SSEA-1, and CD34 do not resume tumor-initiating properties of long-term cultured malignant glio-neuronal stem cells
19725119 Dynamic changes in surface expression of the identified antigens CD15, CD24, and CD29 in combination can be exploited for the experimental separation of key neural cell populations.
19572148 Findings suggest the important role of the CD11b+/CD14/CD15+/CD33+ MDSCs in mediating immunosuppression in NSCLC.
19546439 Data show that CD45, CD11b, CD15, and CD56 were diagnostic parameters with flow cytometry.
19185848 Data show that tumors from a model of medulloblastoma, the Patched mutant mouse, are propagated not by CD133(+) cells but by cells expressing the progenitor markers Math1 and CD15/SSEA-1.
18085638 CD13 was expressed in 73% of acute myeloid leukemia patients, CD15 was expressed in 43% of patients, CD33 was expressed in 64% of patients, and CD34 was expressed in 66% of patients.
18023290 Suppressing the expression of FUT1/4 by RNAi technology reduces the synthesis of LeY and inhibits cancer growth.
17662271 Expression is frequenty decreased in chronic myelogenous leukemia.
17556010 Fucosyltransferase IV overexpression augments Lewis Y expression to trigger neoplastic cell proliferation.
17409497 Granzyme treatment increased cell surface FUT4 expression.
16842926 interaction of sialyl Lewis X antigen with lectin-like receptors on NK cells induces cytotoxicity that is mediated through a tyrosine-phosphorylated 17-kDa protein
15579466 human FucT-IV and -VII both contribute and cooperate in regulating L-selectin-, P-selectin-, and E-selectin-dependent rolling on PSGL-1, with FucT-VII playing a predominant role in conferring selectin binding activity to PSGL-1
15182935 induction of FUT (mainly FUT4), the gene expression of which is mediated by signals downstream of caspase 3, increases Le(X) and Le(Y) expression in apoptotic cells
12738675 Strong activation of Ras represents a major pathway for induction of FucT-VII gene expression in T cells.

AA Sequence

MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGA      1 - 70
GQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAALPVRAMGAPWGSPTAAAGGR     71 - 140
RGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPD    141 - 210
CRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEAL    211 - 280
ATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPL    281 - 350
SRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD    351 - 420
YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRR    421 - 490
SYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER                                  491 - 530
//

Text Mined References (67)

PMID Year Title
26701615 2016 Increased fucosylation has a pivotal role in multidrug resistance of breast cancer cells through miR-224-3p targeting FUT4.
26427914 2015 Cancer-related CD15/FUT4 overexpression decreases benefit to agents targeting EGFR or VEGF acting as a novel RAF-MEK-ERK kinase downstream regulator in metastatic colorectal cancer.
26427350 2016 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions.
26418972 2015 Hodgkin lymphoma cell lines bind to platelets. Incubation with platelets induces CD15 and P-selectin dependent adhesion of the cell lines to Human Umbilical Vein Endothelial cells (HUVEC).
26290260 2016 Expression and prognostic value of putative cancer stem cell markers CD117 and CD15 in choroidal and ciliary body melanoma.
25896022 2015 Baicalin promotes embryo adhesion and implantation by upregulating fucosyltransferase IV (FUT4) via Wnt/beta-catenin signaling pathway.
25869074 2015 [CD15 focus score for diagnostics of periprosthetic joint infections : Neutrophilic granulocytes quantification mode and the development of morphometric software (CD15 quantifier)].
25776515 2015 Fucosyltransferase IV (FUT4) as an effective biomarker for the diagnosis of breast cancer.
25697377 2015 Genome-wide DNA methylation identifies trophoblast invasion-related genes: Claudin-4 and Fucosyltransferase IV control mobility via altering matrix metalloproteinase activity.
25608813 2015 Correlation between FUT4 expression and its promoter methylation in HaCaT cells.
25149387 2014 CD15 - a new marker of pathological villous immaturity of the term placenta.
25121780 2014 Structural characterization of the DC-SIGN-Lewis(X) complex.
25043745 2014 Transient CD15-positive endothelial phenotype in the human placenta correlates with physiological and pathological fetoplacental immaturity.
24425323 2014 High expression of sLex associated with poor survival in Argentinian colorectal cancer patients.
24232099 2013 FUT family mediates the multidrug resistance of human hepatocellular carcinoma via the PI3K/Akt signaling pathway.
24171785 2015 Prognostic molecular markers in head and neck squamous cell carcinoma in a New Zealand population: matrix metalloproteinase-2 and sialyl Lewis x antigen.
24086629 2013 AQP9 expression in glioblastoma multiforme tumors is limited to a small population of astrocytic cells and CD15(+)/CalB(+) leukocytes.
23959823 2014 HSF1 and Sp1 regulate FUT4 gene expression and cell proliferation in breast cancer cells.
23799130 2013 Expression of ST3GAL4 leads to SLe(x) expression and induces c-Met activation and an invasive phenotype in gastric carcinoma cells.
23681114 2013 Differential expression of E-cadherin, ?-catenin, and Lewis x between invasive hydatidiform moles and post-molar choriocarcinomas.
22691873 2012 TNF regulates sialyl-Lewisx and 6-sulfo-sialyl-Lewisx expression in human lung through up-regulation of ST3GAL4 transcript isoform BX.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
22411914 2012 The micro-RNA 199b-5p regulatory circuit involves Hes1, CD15, and epigenetic modifications in medulloblastoma.
22287018 2012 Differential fucosyltransferase IV expression in squamous carcinoma cells is regulated by promoter methylation.
22145955 2012 Differential expression of LeY and fucosyltransferase IV correlates with the receptivity of RL95-2 and HEC-1A human uterine epithelial cells.
22084431 2011 Leukemic priming of resting NK cells is killer Ig-like receptor independent but requires CD15-mediated CD2 ligation and natural cytotoxicity receptors.
21931765 2011 MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma.
21857669 2011 In vitro generation of human cells with cancer stem cell properties.
21635204 2011 Telomere length in myelodysplastic syndromes.
21521691 2011 Regulation of sialyl Lewis antigen expression in colon cancer cells by sialidase NEU4.
21457163 2011 CD15-expressing nodular lymphocyte-predominant Hodgkin lymphoma.
21337384 2011 Cyclophosphamide-induced apoptosis in A431 cells is inhibited by fucosyltransferase IV.
20965272 2011 The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach.
20605574 2011 Difucosylated oligosaccharide Lewis Y is contained within integrin ?v?3 on RL95-2 cells and required for endometrial receptivity.
20506505 2010 Overexpression of fucosyltransferase IV promotes A431 cell proliferation through activating MAPK and PI3K/Akt signaling pathways.
20458727 2010 Expression profile of the embryonic markers nanog, OCT-4, SSEA-1, SSEA-4, and frizzled-9 receptor in human periodontal ligament mesenchymal stem cells.
20181261 2010 CD133, CD15/SSEA-1, CD34 or side populations do not resume tumor-initiating properties of long-term cultured cancer stem cells from human malignant glio-neuronal tumors.
19725119 2009 CD15, CD24, and CD29 define a surface biomarker code for neural lineage differentiation of stem cells.
19572148 2010 Population alterations of L-arginase- and inducible nitric oxide synthase-expressed CD11b+/CD14?/CD15+/CD33+ myeloid-derived suppressor cells and CD8+ T lymphocytes in patients with advanced-stage non-small cell lung cancer.
19546439 2009 Diagnostic utility of flow cytometry in low-grade myelodysplastic syndromes: a prospective validation study.
19185848 2009 Identification of CD15 as a marker for tumor-propagating cells in a mouse model of medulloblastoma.
18085638 2008 Prognostic value of immunophenotyping in elderly patients with acute myeloid leukemia: a single-institution experience.
18023290 2008 Suppression of FUT1/FUT4 expression by siRNA inhibits tumor growth.
17662271 2007 Diminished CD10, CD13, and CD15 expression in a differentiated granulocyte population in CML.
17556010 2007 Overexpression of fucosyltransferase IV in A431 cell line increases cell proliferation.
17409497 2007 Increased expression of Lewis X and Y antigens on the cell surface and FUT 4 mRNA during granzyme B-induced Jurkat cell apoptosis.
16842926 2006 Binding of sialyl Lewis X antigen to lectin-like receptors on NK cells induces cytotoxicity and tyrosine phosphorylation of a 17-kDa protein.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15579466 2005 Regulation of PSGL-1 interactions with L-selectin, P-selectin, and E-selectin: role of human fucosyltransferase-IV and -VII.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15182935 2004 Expression of cell surface Lewis X and Y antigens and FUT4 mRNA is increased in Jurkat cells undergoing apoptosis.
12738675 2003 Induction of FucT-VII by the Ras/MAP kinase cascade in Jurkat T cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11006292 2000 Human alpha (1,3)-fucosyltransferase IV (FUTIV) gene expression is regulated by elk-1 in the U937 cell line.
9756916 1998 Expression cloning and characterization of a novel murine alpha1, 3-fucosyltransferase, mFuc-TIX, that synthesizes the Lewis x (CD15) epitope in brain and kidney.
9186069 1997 Glomerulointerstitial interaction of adhesion molecules in IgA nephropathy and membranoproliferative glomerulonephritis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8287679 1994 The gene encoding myeloid alpha-3-fucosyl-transferase (FUT4) is located between D1 1S388 and D11S919 on 11q21.
8116567 1994 Localization of anti-Leu-M1 (CD15) binding sites in Hodgkin's disease by immunoelectron microscopic examination.
7782074 1995 Physical maps of human alpha (1,3)fucosyltransferase genes FUT3-FUT6 on chromosomes 19p13.3 and 11q21.
7508745 1994 CD62/P-selectin binding sites for myeloid cells and sulfatides are overlapping.
3305706 1987 Monoclonal antibodies that recognize lacto-N-fucopentaose III (CD15) react with the adhesion-promoting glycoprotein family (LFA-1/HMac-1/gp 150,95) and CR1 on human neutrophils.
1718983 1991 Cloning of a human alpha(1,3)-fucosyltransferase gene that encodes ELFT but does not confer ELAM-1 recognition on Chinese hamster ovary cell transfectants.
1716630 1991 Molecular cloning of a human fucosyltransferase gene that determines expression of the Lewis x and VIM-2 epitopes but not ELAM-1-dependent cell adhesion.
1702034 1990 ELFT: a gene that directs the expression of an ELAM-1 ligand.