Property Summary

NCBI Gene PubMed Count 75
PubMed Score 305.04
PubTator Score 218.07

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

Gene RIF (56)

PMID Text
26766790 Polymorphisms in FUT3 and its intestinal expression might be associated with ulcerative colitis pathogenesis.
26663064 Data suggest that fucosyltransferase 3 (FUT3) gene rs28362459 and rs3745635 single nucleotide polymorphisms (SNPs) may engender the increased risk of ileocolonic and ileal Crohn's disease (CD).
26321244 that the absence of alpha1,3/4-fucosyltransferase enzyme is related to breast's invasive breast carcinoma
24720527 Mutations of FUT3 (rs28362459) and (rs3745635) might influence the lesion locations in CD patients.
23958938 Use of FUT2/3 genotype-dependent cut-off values for CA19-9 improved sensitivity and reduced the number of false positive results
23922852 Obtained FST values reveal distinct frequencies of the FUT3 SNPs between the present sample and its representative ancestral populations.
21978830 down-regulation of FUT3 and FUT5 reduces the expression of sialyl-Lewis antigens and the adhesion capacities of gastric cancer cells and allows to identify the specific alpha1-3,4 fucosyltransferases implicated in the Lewis antigens synthesis
21542140 Elevated expression of Topo-I and Topo-II beta is found in Lewis(y) antigen-overexpressing ovarian cancer cells.
20833389 At physiological levels of wall shear stress, the number of flowing cancer cells recruited to the microtube surface was dramatically reduced by FUT3 knockdown
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605574 LeY is carried by integrin alphavbeta3 and plays a critical role in attachment to cultured cells. LeY activates integrin alphavbeta3/focal adhesion kinase (FAK) signaling.
20514537 Lewis-negative genotype was associated with invasive ductal breast carcinoma but not with anatomoclinical parameters
20514537 Observational study of gene-disease association. (HuGE Navigator)
20197723 Observational study of gene-disease association. (HuGE Navigator)
20179215 GALNT14 and FUT3/6 H-scores were significantly higher in non-small cell lung cancer cell lines sensitive to dulanermin and drozitumab versus resistant cell lines
20003467 Increased expression of Lewis y antigen plays an important role in promoting cell proliferation through activating PI3K/Akt signaling pathway in ovarian carcinoma-derived RMG-I cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19715603 in breast cancer there was a limited humoral immune response through Lewis y/IgM/CIC levels detection which correlated with MUC1/IgM/CIC
19572973 Multiple common and sporadic sequence variations including 14 new alleles at FUT1, FUT2, and FUT3 loci were identified.
19349624 results suggested that PKR is the primary target for HSV-1 early RNA during induction of FUT3, FUT5, and FUT6
19175549 Sequence analysis of FUT3 identified many SNPs, but most of them are in complete linkage disequilibrium with previously reported SNPs responsible for the Lewis-negative phenotype.
19175549 Observational study of genotype prevalence. (HuGE Navigator)
19169360 Observational study of gene-disease association. (HuGE Navigator)
19137814 These findings indicate that Lewis y antigen have the ability to enhance the proliferation and elevate the survival rates of RMG-I cells, which can promote the genesis and development of ovarian carcinoma
18977761 Expression of sLex antigen in breast cancer is not associated with breast cancer survival.
18974842 Observational study of gene-disease association. (HuGE Navigator)
18953356 increased CD15 expression is not due to de novo biosynthesis of CD15, but results predominantly from induction of alpha(2-3)-sialidase activity
18803289 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18205178 These observations point to a tumor induced transcription of endothelial FUT1 and consequently an enhanced expression of CD174 which is involved in migration and early cell-cell contacts during tumor associated angiogenesis.
17383304 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17383304 functional mutations of the FUT3 gene may be associated with an increased atherothrombotic disease prevalence, especially among abstainers
17054072 Observational study of gene-disease association. (HuGE Navigator)
16800951 Observational study of genotype prevalence. (HuGE Navigator)
16427187 T3 overexpression in gastric cells depends upon promoter hypomethylation and FUT3 is responsible for overexpression of Le(a) in gastric cells, in vitro
16239964 LeX motif present in human milk can bind to dendritic cell-specific ICAM3-grabbing non-integrin (DC-SIGN), thereby preventing the capture and subsequent transfer of HIV-1 to CD4+ T lymphocytes.
16199102 cloning and characterization of the promoter; strong correlation between the promoter activity and high expression of sialyl Le(a) observed in colon carcinoma cell lines seem to confirm the important regulatory role of FUT3 in synthesis of sialyl Le(a)
16168124 Higher expression of Lewis y/b was more often found in high grade and poor prognosis tumours compared to good prognosis breast cancers.
16097066 Observational study of gene-disease association. (HuGE Navigator)
16008680 Observational study of gene-disease association. (HuGE Navigator)
15832169 Observational study of gene-disease association. (HuGE Navigator)
15639866 Observational study of gene-disease association. (HuGE Navigator)
15639865 Observational study of genotype prevalence. (HuGE Navigator)
15338364 Observational study of gene-disease association. (HuGE Navigator)
15331092 The heterologous enzyme hFUT3 was strongly expressed and fully functional in transgenic tobacco, which showed a delay in growth linked to a reduction of internode length.
14977360 results indicated that Mn2+ bound the enzyme and increased its affinity for the acceptor
14687237 Observational study of gene-disease association. (HuGE Navigator)
12730721 Observational study of gene-disease association. (HuGE Navigator)
12730721 study of the Lewis gene polymorphisms in a Caucasian Portuguese population with a high rate of H. pylori infection, and evaluation of the implications of mutant enzymes in Le(b) expression in the gastric mucosa
12673421 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12493760 Cys, Gln, and Tyr residues are important for FT3wt sorting into the transport vesicles possibly due to interactions with other membrane proteins
12424536 Observational study of genotype prevalence. (HuGE Navigator)
12424536 Distribution of Lewis (FUT3)genotype and allele frequencies by ethnicity in a United States population.
12164325 Observational study of genotype prevalence. (HuGE Navigator)
11819805 Sialy Lewis-X antigens play an important role liver metastases of colon carcinoma.
11668626 PCR using sequence-specific primers DNA enables efficient genotyping of clinical samples
11535550 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTW      1 - 70
PFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPP     71 - 140
PNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYY    141 - 210
QSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSN    211 - 280
YERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRY    281 - 350
QTVRSIAAWFT                                                               351 - 361
//

Text Mined References (76)

PMID Year Title
26766790 2016 Association of Ulcerative Colitis with FUT2 and FUT3 Polymorphisms in Patients from Southeast China.
26663064 2015 [Association of inflammatory bowel disease with the polymorphisms and haplotypes of fucosyltransferase 3 gene].
26321244 2015 Fut3 role in breast invasive ductal carcinoma: Investigating its gene promoter and protein expression.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24720527 2014 Associations of FUT2 and FUT3 gene polymorphisms with Crohn's disease in Chinese patients.
23958938 2013 FUT2 and FUT3 genotype determines CA19-9 cut-off values for detection of cholangiocarcinoma in patients with primary sclerosing cholangitis.
23922852 2013 The Lewis histo-blood group system: molecular analysis of the 59T>G, 508G>A, and 1067T>A polymorphisms in an Amazonian population.
21978830 2011 Down-regulation of FUT3 and FUT5 by shRNA alters Lewis antigens expression and reduces the adhesion capacities of gastric cancer cells.
21542140 2011 Overexpression of Lewis(y) antigen protects ovarian cancer RMG-1 cells from carboplatin-induced apoptosis by the upregulation of Topo-I and Topo-II ?.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
20833389 2010 Knockdown of fucosyltransferase III disrupts the adhesion of circulating cancer cells to E-selectin without affecting hematopoietic cell adhesion.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605574 2011 Difucosylated oligosaccharide Lewis Y is contained within integrin ?v?3 on RL95-2 cells and required for endometrial receptivity.
20514537 2010 Polymorphisms of Lewis and Secretor genes are related to breast cancer and metastasis in axillary lymph nodes.
20197723 2010 The relationship between Lewis/Secretor genotypes and serum carbohydrate antigen 19-9 levels in a Korean population.
20179215 2010 Development of immunohistochemistry assays to assess GALNT14 and FUT3/6 in clinical trials of dulanermin and drozitumab.
20003467 2009 Lewis y antigen promotes the proliferation of ovarian carcinoma-derived RMG-I cells through the PI3K/Akt signaling pathway.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19715603 2009 Breast cancer humoral immune response: involvement of Lewis y through the detection of circulating immune complexes and association with Mucin 1 (MUC1).
19572973 2009 Identification of 14 new alleles at the fucosyltransferase 1, 2, and 3 loci in Styrian blood donors, Austria.
19349624 2009 Activation of host antiviral RNA-sensing factors necessary for herpes simplex virus type 1-activated transcription of host cell fucosyltransferase genes FUT3, FUT5, and FUT6 and subsequent expression of sLe(x) in virus-infected cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19175549 2009 Genetic variation of FUT3 in Ghanaians, Caucasians, and Mongolians.
19169360 2009 Histo-blood group gene polymorphisms as potential genetic modifiers of infection and cystic fibrosis lung disease severity.
19137814 2008 [alpha1,2-fucosyltransferase gene transfection influences on biological behavior of ovarian carcinoma-derived RMG-I cells].
18977761 2008 Is Sialyl Lewis x antigen expression a prognostic factor in patients with breast cancer?
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18953356 2008 CD15 expression in human myeloid cell differentiation is regulated by sialidase activity.
18803289 2008 Smoking and serum CA19-9 levels according to Lewis and secretor genotypes.
18205178 2008 Involvement of alpha 1-2-fucosyltransferase I (FUT1) and surface-expressed Lewis(y) (CD174) in first endothelial cell-cell contacts during angiogenesis.
17383304 2007 Fucosyltransferase 3 polymorphism and atherothrombotic disease in the Framingham Offspring Study.
17054072 2006 Antibody prevalence and titer to norovirus (genogroup II) correlate with secretor (FUT2) but not with ABO phenotype or Lewis (FUT3) genotype.
16800951 2006 [FUT3 gene polymorphism associated with Lewis blood group in Chinese Zhejiang population].
16427187 2006 Expression of Lea in gastric cancer cell lines depends on FUT3 expression regulated by promoter methylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16239964 2005 Lewis X component in human milk binds DC-SIGN and inhibits HIV-1 transfer to CD4+ T lymphocytes.
16199102 2005 Promoter analysis of the human alpha1,3/4-fucosyltransferase gene (FUT III).
16168124 2005 High expression of Lewis y/b antigens is associated with decreased survival in lymph node negative breast carcinomas.
16097066 2005 Lewis blood genotypes of peptic ulcer and gastric cancer patients in Taiwan.
16008680 2005 ABO/secretor genetic complex is associated with the susceptibility of childhood asthma in Taiwan.
15832169 2005 The Lewis blood group--a new genetic marker of obesity.
15639866 2003 [Analysis of polymorphisms on Lewis blood group antigen related SE gene in the populations in Shandong with high-risk of gastric cancer and Beijing].
15639865 2003 [Analysis of Lewis gene polymorphism in high and low incidence area of gastric cancer in Shandong province].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15338364 2004 Association of Lewis and Secretor gene polymorphisms and Helicobacter pylori seropositivity among Japanese-Brazilians.
15331092 Alteration of gibberellin response in transgenic tobacco plants which express a human Lewis fucosyltransferase.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14977360 2004 Effect of the manganese ion on human alpha3/4 fucosyltransferase III activity.
14687237 2004 Association of the Lewis genotype with cardiovascular risk factors and subclinical carotid atherosclerosis: the Atherosclerosis Risk in Communities (ARIC) study.
12730721 2003 Lewis enzyme (alpha1-3/4 fucosyltransferase) polymorphisms do not explain the Lewis phenotype in the gastric mucosa of a Portuguese population.
12673421 2003 ABO blood type, Lewis and Secretor genotypes, and chronic atrophic gastritis: a cross-sectional study in Japan.
12668675 2003 Synthesis of disialyl Lewis a (Le(a)) structure in colon cancer cell lines by a sialyltransferase, ST6GalNAc VI, responsible for the synthesis of alpha-series gangliosides.
12493760 2003 Importance of Cys, Gln, and Tyr from the transmembrane domain of human alpha 3/4 fucosyltransferase III for its localization and sorting in the Golgi of baby hamster kidney cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424536 2002 Distribution of Lewis (FUT3)genotype and allele: frequencies in a biethnic United States population.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11535550 2001 Polymorphisms of two fucosyltransferase genes (Lewis and Secretor genes) involving type I Lewis antigens are associated with the presence of anti-Helicobacter pylori IgG antibody.
10816554 2000 Human alpha 1,3/4 fucosyltransferases. Characterization of highly conserved cysteine residues and N-linked glycosylation sites.
10394050 1999 Plasma alpha1,3-fucosyltransferase deficiency in schizophrenia.
10089211 1999 Molecular behavior of mutant Lewis enzymes in vivo.
9703429 1998 Five novel missense mutations of the Lewis gene (FUT3) in African (Xhosa) and Caucasian populations in South Africa.
9268337 1997 Significance of individual point mutations, T202C and C314T, in the human Lewis (FUT3) gene for expression of Lewis antigens by the human alpha(1,3/1,4)-fucosyltransferase, Fuc-TIII.
8943285 1996 Influence of Lewis alpha1-3/4-L-fucosyltransferase (FUT3) gene mutations on enzyme activity, erythrocyte phenotyping, and circulating tumor marker sialyl-Lewis a levels.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8801770 1996 DNA sequencing and screening for point mutations in the human Lewis (FUT3) gene enables molecular genotyping of the human Lewis blood group system.
8240337 1993 Alpha (1,3/1,4)fucosyltransferase (FucT-III) gene is inactivated by a single amino acid substitution in Lewis histo-blood type negative individuals.
8240322 1993 Genotypic heterogeneity among Lewis negative individuals.
8219240 1993 Analysis of Lewis fucosyltransferase genes from the human gastric mucosa of Lewis-positive and -negative individuals.
8063716 1994 Molecular basis for Lewis alpha(1,3/1,4)-fucosyltransferase gene deficiency (FUT3) found in Lewis-negative Indonesian pedigrees.
7961897 1994 Molecular genetic analysis of the human Lewis histo-blood group system.
7916594 1993 Human alpha-1,3 fucosyltransferase (FucT-VI) gene is located at only 13 kb 3' to the Lewis type fucosyltransferase (FucT-III) gene on chromosome 19.
7656588 1995 Relative positions of two clusters of human alpha-L-fucosyltransferases in 19q (FUT1-FUT2) and 19p (FUT6-FUT3-FUT5) within the microsatellite genetic map of chromosome 19.
7650030 1995 Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms.
1977660 1990 A cloned human cDNA determines expression of a mouse stage-specific embryonic antigen and the Lewis blood group alpha(1,3/1,4)fucosyltransferase.
1740457 1992 Isolation of a novel human alpha (1,3)fucosyltransferase gene and molecular comparison to the human Lewis blood group alpha (1,3/1,4)fucosyltransferase gene. Syntenic, homologous, nonallelic genes encoding enzymes with distinct acceptor substrate specificities.