Property Summary

NCBI Gene PubMed Count 128
PubMed Score 1122.92
PubTator Score 527.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.066 9.3e-03
active ulcerative colitis 1.075 2.0e-02
colon cancer -1.100 3.1e-02
intraductal papillary-mucinous adenoma (... 2.000 1.0e-03
intraductal papillary-mucinous carcinoma... 1.800 1.0e-02
intraductal papillary-mucinous neoplasm ... 3.200 9.2e-04
lung adenocarcinoma 1.600 1.6e-13
lung cancer 1.500 2.1e-03
nasopharyngeal carcinoma -1.400 7.1e-09
non-small cell lung cancer 1.474 2.4e-15
pancreatic cancer 1.600 1.7e-05
psoriasis 1.200 2.1e-06
spina bifida -1.104 4.0e-02
urothelial carcinoma -1.400 1.2e-02

Gene RIF (99)

AA Sequence

MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIG      1 - 70
RLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHI     71 - 140
PGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMP    141 - 210
KVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQ    211 - 280
CNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH           281 - 343
//

Text Mined References (130)

PMID Year Title