Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.18
PubTator Score 3.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25126723 The BCL2L1-PGAM5-FUNDC1 axis is critical for receptor-mediated mitophagy.
24671035 FUNDC1 regulates ULK1 recruitment to damaged mitochondria, where FUNDC1 phosphorylation by ULK1 is crucial for mitophagy.
22267086 Data show that Knockdown of endogenous FUNDC1 significantly prevented hypoxia-induced mitophagy, which could be reversed by the expression of wild-type FUNDC1.

AA Sequence

MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQK      1 - 70
VGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIV     71 - 140
ISSGFVGGFLLGLAS                                                           141 - 155
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25126723 2014 The BCL2L1 and PGAM5 axis defines hypoxia-induced receptor-mediated mitophagy.
24700572 2014 A novel EBP c.224T>A mutation supports the existence of a male-specific disorder independent of CDPX2.
24671035 2014 ULK1 translocates to mitochondria and phosphorylates FUNDC1 to regulate mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22267086 2012 Mitochondrial outer-membrane protein FUNDC1 mediates hypoxia-induced mitophagy in mammalian cells.
20562859 2010 Network organization of the human autophagy system.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18957941 2010 Genome-wide association scan for five major dimensions of personality.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.