Property Summary

NCBI Gene PubMed Count 53
PubMed Score 186.91
PubTator Score 125.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.042 7.5e-03
Multiple myeloma 1.042 9.3e-04
malignant mesothelioma -5.500 2.2e-09
esophageal adenocarcinoma 1.100 1.9e-02
osteosarcoma -1.844 5.6e-04
glioblastoma 1.800 2.5e-02
intraductal papillary-mucinous adenoma (... 1.200 1.4e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
lung cancer -1.400 3.8e-04
diabetes mellitus -1.300 1.0e-02
invasive ductal carcinoma 1.050 1.3e-02
ulcerative colitis -1.200 2.0e-08
ovarian cancer 2.100 4.5e-05

 OMIM Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (15)

PMID Text
26204487 FUCA1 downregulation confers inferior survival for triple-negative breast cancer patients by modulating the glycosylation status of the tumor cell surface
25129443 Serum alpha-L-fucosidase levels were significantly elevated in hepatocellular carcinoma.
24569461 Preoperative serum AFU is a prognostic predictor of hepatocellular carcinoma.
24469468 IL-13, IL-4 and IL-5 have no effect on the expression of FUCA1 and FUCA2, but its expression is upregulated by IFN-gamma, a Th1 cytokine.
23965968 Diminished FUCA1 mRNA levels in tumors, indicate that expression of tissue alpha-L-fucosidase could be regulated at transcriptional level in colorectal cancer.
23911047 We observed significant lower values of GAL, alpha-fucosidase and tendency to decrease of MAN and GLU concentration in nasal polyps
23898208 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of fucosidase, alpha-L-1 (FUCA1) in peptide-treated PBMCs
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of fucosidase, alpha-L-1 (FUCA1) in peptide-treated PBMCs
22763966 In the serum of patients with Lyme disease, GAL activity significantly increased (p = 0.029), and the activity of FUC had a tendency to increase (p = 0.153), compared to the control group.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19782187 Data show that the correlation between the fluorescence activity of the enzyme AFU by the developed procedures and the standard method was positive and highly significant in patients and controls.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18217416 following HIV infection, there is an increased rate of catabolism of glycoconjugates in saliva resulting from changes in the proportions of the activity of isoenzymes A and B of N-acetyl-beta-hexosaminidase, beta-galactosidase and alpha-fucosidase
17133604 The fucosidase has a role in the intimate species signature interactions between sperm and oocyte.
16773698 The purified alpha-L-fucosidase from primary hepatocarcinoma (PHC) is different in its properties from alpha-L-fucosidase in human other organs. The polyclonal antibody prepared in this experiment can be applied to the diagnosis of PHC.

AA Sequence

MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGVFIHWGVFSVP      1 - 70
AWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHE     71 - 140
GFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAK    141 - 210
TMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCE    211 - 280
DKFKPQSLPDHKWEMCTSIDKFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPI    281 - 350
FQERLLAVGKWLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK    351 - 420
ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK                            421 - 466
//

Text Mined References (57)

PMID Year Title
26204487 2015 Down-regulation of ?-L-fucosidase 1 expression confers inferior survival for triple-negative breast cancer patients by modulating the glycosylation status of the tumor cell surface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25129443 2014 Evaluation of squamous cell carcinoma antigen-immunoglobulin M complex (SCCA-IGM) and alpha-L-fucosidase (AFU) as novel diagnostic biomarkers for hepatocellular carcinoma.
24569461 2014 Alpha-1-fucosidase as a prognostic indicator for hepatocellular carcinoma following hepatectomy: a large-scale, long-term study.
24469468 2014 Modulation of expression in BEAS-2B airway epithelial cells of ?-L-fucosidase A1 and A2 by Th1 and Th2 cytokines, and overexpression of ?-L-fucosidase 2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23965968 2013 Decreased expression of alpha-L-fucosidase gene FUCA1 in human colorectal tumors.
23911047 Lysosomal exoglycosidases in nasal polyps.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22763966 2012 Alpha fucosidase and beta galactosidase in serum of a Lyme disease patients as a possible marker of accelerated senescence - a preliminary study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19782187 2009 Spectrofluorimetric method for measuring the activity of the enzyme alpha-L-fucosidase using the ion associate of 2-chloro-4-nitro phenol-rhodamine-B.
19666478 2009 Role for alpha-L-fucosidase in the control of Helicobacter pylori-infected gastric cancer cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18217416 2007 Activity of lysosomal exoglycosidases in saliva of patients with HIV infection.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17133604 2007 Crypticity and functional distribution of the membrane associated alpha-L-fucosidase of human sperm.
16773698 2006 Purification and characterization of alpha-L-fucosidase from human primary hepatocarcinoma tissue.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408193 2002 A novel FUCA1 mutation causing fucosidosis in a Chinese boy.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11549468 2001 New leads for selective inhibitors of alpha-L-fucosidases. Synthesis and glycosidase inhibitory activities of [(2R,3S,4R)-3,4-dihydroxypyrrolidin-2-yl]furan derivatives.
11389735 2001 Cell surface human alpha-L-fucosidase.
10094192 1999 Spectrum of mutations in fucosidosis.
9781852 1998 Partial properties of four glycosidases in normal human lens and variations in their enzyme activities during aging and with the advance of lens coloration.
9762612 1998 A fucosidosis patient with relative longevity and a missense mutation in exon 7 of the alpha-fucosidase gene.
8673729 1996 Elevation of acid glycosidase activities in thyroid and gastric tumors.
8504303 1993 Fucosidosis: four new mutations and a new polymorphism.
8401503 1993 Six additional mutations in fucosidosis: three nonsense mutations and three frameshift mutations.
8399358 1993 Pedigree analysis of alpha-L-fucosidase gene mutations in a fucosidosis family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8097260 1993 A 5' splice site mutation in fucosidosis.
7874128 1994 A missense mutation (S63L) in alpha-L-fucosidase is responsible for fucosidosis in an Italian patient.
7827138 1995 Change of isoforms' spectra of alpha-L-fucosidase from human skin fibroblasts in intracellular storage of nonhydrolyzable substances.
7815431 1994 Molecular basis of the common electrophoretic polymorphism (Fu1/Fu2) in human alpha-L-fucosidase.
6096099 1984 Chromogenic immunodetection of human serum albumin and alpha-L-fucosidase clones in a human hepatoma cDNA expression library.
4074382 1985 Molecular defect in processing alpha-fucosidase in fucosidosis.
4052017 1985 Solubilization and characterization of pellet-associated human brain alpha-L-fucosidase activity.
3817676 1987 alpha-L-fucosidase phenotyping in human tissues, dental pulps and hair roots.
3780313 1986 Chromosome 1 localization of the human alpha-L-fucosidase structural gene with a homologous site on chromosome 2.
2983333 1985 Molecular cloning of a cDNA for human alpha-L-fucosidase.
2894306 1987 Molecular biology of the alpha-L-fucosidase gene and fucosidosis.
2803312 1989 Human alpha-L-fucosidase: complete coding sequence from cDNA clones.
2642067 1989 Characterization of EcoRI mutation in fucosidosis patients: a stop codon in the open reading frame.
2174090 1990 Sequencing and expression of a full-length cDNA for human alpha-L-fucosidase.
2012122 1991 Fucosidosis revisited: a review of 77 patients.
1281988 1992 A mutation generating a stop codon in the alpha-L-fucosidase gene of a fucosidosis patient.