Property Summary

NCBI Gene PubMed Count 53
PubMed Score 33.36
PubTator Score 44.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.100 1.6e-06
psoriasis -1.400 4.1e-07
osteosarcoma -1.067 2.2e-03
group 3 medulloblastoma 1.700 8.1e-03
Amyotrophic Lateral Sclerosis 1.149 2.7e-06
intraductal papillary-mucinous adenoma (... 1.300 2.2e-02
intraductal papillary-mucinous carcinoma... 1.700 6.0e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
breast carcinoma 1.300 7.6e-04
Pick disease -1.900 3.4e-05
progressive supranuclear palsy -2.100 5.3e-03
Breast cancer -1.300 2.8e-10

Pathway (1)

Gene RIF (30)

PMID Text
26901106 direct connection between the cellular PI3K/AKT/mTOR signaling pathway, frequently activated in human hepatocarcinogenesis, and the enrichment of oncogenic transcription factors of the FBP family
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in FUBP1 promoter have now been identified in the majority of oligodendrogliomas
26177862 Concomitant overexpression of far upstream element (FUSE) binding protein (FBP) interacting repressor (FIR) and its splice variants induce migration and invasion of non-small cell lung cancer cells.
25995247 FBP1 promotes hepatitis C virus eplication by inhibiting p53 expression.
24966911 Apoptosis-mediated cleavage of FBP1 and its decreased expression in epithelial cells induces cell cycle arrest, which may play an important role in colonic epithelial disruption in colitis.
24798327 These findings are the first report describing the regulation of alternative splicing of MDM2 mediated by the oncogenic factor FUBP1.
24347226 High FBP1 expression was observed in glioma.
24192769 FUBP1 expression differs among gastric tissues; there is a correlation between overall survival rates and age, sex, lymph node metastasis, and distant metastasis.
24117486 The data indicates an association between FUBP1 expression and proliferation in gliomas.
24030748 We conclude that absent CIC and FUBP1 expressions are potential markers of shorter time to recurrence in oligodendroglial tumors.
23818605 Far upstream element-binding protein 1 and RNA secondary structure both mediate second-step splicing repression.
22926519 biochemical features of FBP1
22869205 Analysis allowed us to define two highly recurrent genetic signatures in gliomas: IDH1/ATRX (I-A) and IDH1/CIC/FUBP1 (I-CF).
22588899 Found CIC and FUBP1 mutations in oligodendrogliomas and demonstrate the presence of these mutations in oligoastrocytomas.
21855647 The central domain of FBP1, containing four K homology motifs, was required for p27 5'-UTR RNA binding and the N terminal domain was important for translational activation.
21817013 CIC gene was mutated in 6 oligodendrogliomas and FUBP1 gene was mutated in 2; 27 additional oligodendrogliomas showed 12 and 3 more tumors with mutations of CIC and FUBP1; results suggest role of these genes in biology and pathology of oligodendrocytes
21779003 increased polyubiquitination of FBP1 does not alter its protein stability, but instead modulates the stable recruitment of FBP1 to target loci
21367899 The authors suggest that FUSE binding protein 1 binds with the Japanese encephalitis virus untranslated RNA and functions as a host anti-virus defense molecule by repressing viral protein expression.
20802533 Authors propose that FBP1 is a key regulator of cell growth and proliferation through its ability to selectively bind the NPM 3' UTR and repress NPM translation.
20420426 The noncoding strand FUSE recruits an activator FUSE-binding protein (FBP) and a repressor FBP-interacting repressor (FIR) to fine-tune c-myc transcription.
19637194 FBP1 is an important oncoprotein overexpressed in hepatocellular carcinoma that induces tumor propagation through direct or indirect repression of cell cycle inhibitors and proapoptotic target genes.
19585652 The coordinated activation of FBP-1 and FBP-2 represents a novel and frequent pro-tumorigenic mechanism promoting proliferation (tumor growth) and motility (dissemination) of human liver cancer cells.
19219071 oncogenic potential of c-Myc is 'switched off' after apoptosis induction as a consequence of the caspase-mediated cleavage of FBP-1.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19087307 study found that FBP1 as well as FBP3 are more frequently expressed in prostate and bladder cancer than in renal cancer; in addition, a positive correlation between levels of FBP1, FBP3 and c-Myc was exclusively detectable in renal cell carcinomas
19015535 investigate the contributions of FBP's 4 K Homology (KH) domains to sequence selectivity. EMSA and missing contact point analysis revealed that FBP contacts 4 separate patches spanning a large segment of FUSE
19003864 The over-expression of a novel protein family, far upstream binding proteins (FUBPs) was identified in both stages of hepatocellular carcinoma and confirmed by western blots.
17676665 HIV-1 gp120 downregulates the expression of far upstream element-binding protein in T-cell lines and umbilical cord blood mononuclear cells
16672220 FUBP1 is an authentic substrate of Parkin that might play an important role in development of Parkinson disease pathology along with aminoacyl-tRNA synthetase interacting multifunctional protein type 2
16628215 Results describe the roles of the FarUpStream Element (FUSE), FUSE Binding Protein (FBP), FBP Interacting Repressor (FIR), and TFIIH in the regulation of c-myc expression.

AA Sequence

MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDG      1 - 70
DQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDS     71 - 140
GGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQ    141 - 210
LQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDV    211 - 280
PIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGN    281 - 350
PGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA    351 - 420
DPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYN    421 - 490
PGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAP    491 - 560
TTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTS    561 - 630
PQGMPQHPPAPQGQ                                                            631 - 644
//

Text Mined References (63)

PMID Year Title
26901106 2016 PI3K/AKT/mTOR-dependent stabilization of oncogenic far-upstream element binding proteins in hepatocellular carcinoma cells.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26177862 2015 Concomitant expression of far upstream element (FUSE) binding protein (FBP) interacting repressor (FIR) and its splice variants induce migration and invasion of non-small cell lung cancer (NSCLC) cells.
25995247 2015 FUSE Binding Protein 1 Facilitates Persistent Hepatitis C Virus Replication in Hepatoma Cells by Regulating Tumor Suppressor p53.
24966911 2014 Role of far upstream element binding protein 1 in colonic epithelial disruption during dextran sulphate sodium-induced murine colitis.
24798327 2014 The splicing factor FUBP1 is required for the efficient splicing of oncogene MDM2 pre-mRNA.
24347226 2015 Expression of far upstream element (FUSE) binding protein 1 in human glioma is correlated with c-Myc and cell proliferation.
24192769 2013 Far upstream element-binding protein 1 (FUBP1) is overexpressed in human gastric cancer tissue compared to non-cancerous tissue.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24117486 2014 Loss of FUBP1 expression in gliomas predicts FUBP1 mutation and is associated with oligodendroglial differentiation, IDH1 mutation and 1p/19q loss of heterozygosity.
24030748 2014 Loss of CIC and FUBP1 expressions are potential markers of shorter time to recurrence in oligodendroglial tumors.
23818605 2013 Far upstream element-binding protein 1 and RNA secondary structure both mediate second-step splicing repression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926519 2013 Far upstream element binding protein 1: a commander of transcription, translation and beyond.
22869205 2012 Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22588899 2012 CIC and FUBP1 mutations in oligodendrogliomas, oligoastrocytomas and astrocytomas.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21855647 2011 Far upstream element binding protein 1 activates translation of p27Kip1 mRNA through its internal ribosomal entry site.
21817013 2011 Mutations in CIC and FUBP1 contribute to human oligodendroglioma.
21779003 2011 USP22 regulates cell proliferation by deubiquitinating the transcriptional regulator FBP1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21367899 2011 FUSE binding protein 1 interacts with untranslated regions of Japanese encephalitis virus RNA and negatively regulates viral replication.
21285945 2011 JTV1 co-activates FBP to induce USP29 transcription and stabilize p53 in response to oxidative stress.
21269460 2011 Initial characterization of the human central proteome.
20802533 2011 Identification of FUSE-binding protein 1 as a regulatory mRNA-binding protein that represses nucleophosmin translation.
20420426 2010 Quantitative characterization of the interactions among c-myc transcriptional regulators FUSE, FBP, and FIR.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19637194 2009 Overexpression of the far upstream element binding protein 1 in hepatocellular carcinoma is required for tumor growth.
19585652 2009 Overexpression of far upstream element binding proteins: a mechanism regulating proliferation and migration in liver cancer cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19219071 2009 Far upstream element-binding protein-1, a novel caspase substrate, acts as a cross-talker between apoptosis and the c-myc oncogene.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19087307 2008 The FUSE binding proteins FBP1 and FBP3 are potential c-myc regulators in renal, but not in prostate and bladder cancer.
19015535 2008 Hierarchical mechanisms build the DNA-binding specificity of FUSE binding protein.
19003864 2008 2-D DIGE profiling of hepatocellular carcinoma tissues identified isoforms of far upstream binding protein (FUBP) as novel candidates in liver carcinogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16672220 2006 Identification of far upstream element-binding protein-1 as an authentic Parkin substrate.
16628215 2006 The FUSE/FBP/FIR/TFIIH system is a molecular machine programming a pulse of c-myc expression.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12819782 2003 Downregulation of FUSE-binding protein and c-myc by tRNA synthetase cofactor p38 is required for lung cell differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176931 2002 Large-scale proteomic analysis of the human spliceosome.
11875576 2002 Structure and dynamics of KH domains from FBP bound to single-stranded DNA.
11239393 2001 Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum.
11222755 2001 Identification of human DNA helicase V with the far upstream element-binding protein.
11071946 2000 Nuclear targeting determinants of the far upstream element binding protein, a c-myc transcription factor.
11003644 2000 Cooperative assembly of an hnRNP complex induced by a tissue-specific homolog of polypyrimidine tract binding protein.
10882074 2000 The FBP interacting repressor targets TFIIH to inhibit activated transcription.
10734235 2000 The survival motor neuron protein interacts with the transactivator FUSE binding protein from human fetal brain.
8125259 1994 A sequence-specific, single-strand binding protein activates the far upstream element of c-myc and defines a new DNA-binding motif.