Property Summary

NCBI Gene PubMed Count 142
PubMed Score 241.98
PubTator Score 129.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer 1.100 8.7e-03
lung carcinoma -1.200 1.1e-18

Protein-protein Interaction (7)

Gene RIF (82)

PMID Text
26871431 FTL expression was higher in glioblastoma than in low-grade glioma, and decreased expression of FTL correlated with increased survival in glioblastoma patients.
26611853 Ferritin plasma levels increased significantly following stem cell transplantation in graft rejection patients.
26602884 Ferritin light chain and ferritin heavy chain are required for the neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26518749 Studies indicate that the the best characterized cytosolic ferritins in mammals are encoded by two genes, FTH and FTL, with four exons and similar structures.
25976471 Single nucleotide polymorphisms in HAMP, BMP2, FTL and SLC40A1 genes have phenotype-modifying roles in hereditary hemochromatosis type 1.
25720123 FTL gene mutation and persistent hyperferritinemia without iron deficiency anemia after phlebotomy
25447222 This study demostrated that FTL mutation progressive brain iron dysregulation, morphological signs of early neurodegeneration and motor coordination deficits show
25327288 provide a new mechanism for selective autophagy of ferritin and reveal a previously unappreciated role for autophagy and NCOA4 in the control of iron homeostasis in vivo
25162662 Genome-wide association study identifies variants in PMS1 associated with serum ferritin in a Chinese population.
24983587 Genetic testing confirmed the diagnosis of hereditary hyperferritinemia cataract syndrome (HHCS), demonstrating a C39>G (c.-161C>G) mutation into FTL gene.
24825732 findings expand the genetic and clinical diversity of neuroferritinopathy and suggest CSF ferritin levels as a novel potential biochemical marker for the diagnosis of neuroferritinopathy.
24821637 Elevated cerebrospinal ferritin reliably (but unspecifically) indicates severe central nervous system disease.
24512320 Data suggest that iron-independent effects of ferritin in myeloma should be prospectively investigated in preclinical and clinical studies.
24306042 Plasma hepcidin-25 and ferritin light chain levels correlate with a malignant breast cancer diagnosis.
24195075 Through combining serum ferritin and MS spectral data, the diagnosis sensitivity and specificity of our model for prewarning severe aGVHD (III~IV degrees aGVHD) before transplant all increased to 90.0%
24022025 A c.-171C>G mutation in the iron-regulatory element of FTL was found in 2 members of a Spanish family with hyperferritinemia-cataract syndrome.
23969999 Increased levels of ferritin light chain protein is associated with breast cancer.
23892696 Data indicate that serum highest TNF-alpha and IL-6 and higher ferritin are among those with intense steatosis.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ferritin, light polypeptide (FTL) expression by HIV-1 Vpr in Vpr transduced macrophages
23699174 Data show the transcriptional regulation of the human ferritin gene by coordinated regulation of Nrf2 and protein arginine methyltransferases PRMT1 and PRMT4.
23685131 Together, our results suggest that iron can increase gamma-secretase activity through promoting the level of FTL that interacts with and stabilizes PEN-2
23592921 Noncoding G-to-T transversion (c.-168G>T) located in the iron response element (IRE) of the gene coding for ferritin light chain (FTL) cosegregated with cataract in the family.
23421845 The Badalona 36C > U and Heidelberg 52 G > C mutations within the L-ferritin Iron-Responsive Element only mildly alter the binding capacity of the Iron Regulatory Proteins but are still causative for hyperferritinaemia cataract syndrome.
23381919 Elevated levels of ferritin are associated with type 2 diabetes mellitus.
23300545 Elevation in ferritin is associated with response to trastuzumab in breast cancer.
23119080 Data indicate that ferritin levels and hyperuricemia are two independently significant factors associated with alanine aminotransferase (ALT) elevation among obese adolescents.
23029420 Plasma levels of FLT and S100A9 proteins are up-regulated and CNDP1 levels are down-regulated in patients with glioblastoma.
22871034 Urine ferritin levels are elevated significantly in systemic lupus erythematosus and correlate with disease activity.
22760008 Increased levels of ferritin and decreased total antioxidant status indicated increasing inflammation in chronic hepatitis C.
22535864 Two novel missense L-ferritin variants are associated with hyperglycosylation, p.Gln26Ile and p.Ala27Val, and with benign hyperferritinemia in two unrelated patients.
22359459 The data strongly suggest that FTL and SCCA1 may serve as coreceptors in HBV cellular attachment and virus entry into hepatocytes.
22348978 data demonstrate an enhanced propensity of mutant ferritin to undergo iron-catalyzed oxidative damage and support this as a mechanism causing disruption of ferritin structure and iron mishandling that contribute to pathology of hereditary ferritinopathy
22248276 High ferritin is associated with poor treatment response in hematological neoplasms.
22117997 There was a positive correlation between reactive oxygen species levels and serum ferritin levels in myelodysplastic syndrome patients
22020773 Molecular genetic analysis revealed point mutations within the FTL IRE.
21907119 Genetic analysis revealed mutation G32A in Pedigree 1 and mutation G32T in Pedigree 2, both heterozygous and located in the iron-responsive element of the ferritin light chain mRNA in hyperferritinemia cataract syndrome.
21696736 genetic variations in the HFE gene, but not plasma ferritin may have a role in coronary heart disease in Chinese
21555518 FTL is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21541272 In the family with hyperferritinemia cataract syndrome a G-->C heterozygous mutation at position +32 of FTL was identified.
21139976 Somatic mutations in the iron response elements (IRE) of the L-ferritin gene are infrequent in the age-related cataract.
21029774 The study shows the facile assembly of mutant FTL and FTH1 subunits into soluble ferritin heteropolymers, but their ability to incorporate iron was significantly reduced relative to wild-type-FTL/FTH1 heteropolymers.
20689807 Observational study of gene-disease association. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20345975 Toluene diisocyanate (TDI) regulates haem oxygenase-1/ferritin expression: implications for toluene diisocyanate-induced asthma.
20159981 biochemical and crystallographic characterization of pathogenic FTL mutant p.Phe167SerfsX26 showing that it is a functional ferritin with an altered conformation of the C terminus
20088381 Expression of FTL and FTH genes encoding ferretin subunits in lung and renal carcinomas
19923220 the x-ray crystallographic structure and report functional studies of ferritin homopolymers formed from the mutant FTL polypeptide
19787796 identified mutations in HFE, SLC40A1, HAMP, HJV, TFR2, and FTL that could explain TRANSFERRIN SATURATION/SERUM FERRITIN heterogeneity in adults with previous HFE genotyping to detect C282Y and H63D; results were correlated with racial groups
19781644 indicate that cellular iron imbalance and oxidative damage produced by the over-expression in of two pathogenic L-ferritin variants are primary causes of cell death, while aggregate formation is a secondary effect
19519778 gene expression analysis of iron management proteins in the liver of trangenic mice indicates that the FTL transgenic mouse liver is iron deficient
19318681 Finding not only supports direct evidence for a regulatory role of L-ferritin in neuroectodermal cell pigmentation but also integrates a new player within a complicated network governing iron homeostasis in the dopamine neurons of substantia nigra.
19254706 Study hypothesize that changes in the expression of the L ferritin might be linked, at least to a certain extent, to the pathogenesis of this rare eye disease.
19176363 The missense mutation of FTL represents a new cause of genetic hyperferritinemia without iron overload, and the mutation may increase the efficacy of L ferritin secretion by increasing the hydrophobicity of the N terminal "A" alpha helix.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18755684 hereditary ferritinopathy pathogenesis is likely to result from a combination of reduction in iron storage function
18665827 the rate of change of serum ferritin in untreated HFE (hemochromatosis protein) C282Y homozygotes is highly variable and may increase or decrease over time
18621011 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of ferritin, light polypeptide (FTL) expression by HIV-1 Vpr in Vpr transduced macrophages
18586377 placental Ferritin protein expression decreased slightly in mild anemia but significantly in moderate anemia
18413574 In exon 4 of the FTL gene, duplication of the 469-484 sequence is found replacing the C-terminal 14 amino acid residues with a novel 23 amino acid sequence.
18160403 FTL and FTH subunits respond independently to cellular iron concentrations
18061976 metacarpophalangeal arthropathy was independently associated with older age, higher ferritin, the presence of the C282Y +/+ and C282Y/H63D hemochromatosis protein(HFE) genotypes and higher percentage of transferrin saturation.
17970701 Observational study of gene-disease association. (HuGE Navigator)
17761032 We have detected a significant inverse correlation of -0.565 (P<0.0001) between serum ferritin when <50 microg/L and FGF-23.
17660802 FTL is a marker gene useful for stratifying osteosarcoma patients into low- and high-risk groups and predicting therapy outcome.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17459943 Demonstrated iron uptake by ferritins into multiple organs. Uptake is greater when iron delivered by H-ferritin compared to L-ferritin.
16858508 Observational study of genotype prevalence. (HuGE Navigator)
16822677 The findings suggest that the pathogenic effects of Ln1 expression are more likely due to deregulation of cellular iron homeostasis rather than to protein conformational problems.
16790936 X-ray structures of recombinant human L-chain ferritin (HuLF) show a cluster of acidic residues at the ferrihydrite nucleation site and at the iron channel along the threefold axis, and an ordered Cd2+ structure within the iron channel.
16252260 These results demonstrate that, in a human metastatic melanoma cell line, the stress condition promoted by L-ferritin down-modulation, can substantially influence proper maturation of tyrosinase
16222695 Quantitative RNA analysis confirmed down-regulation of ferritin light polypeptide and insulin-like growth factor binding protein 1 in hydatiform mole increased incidence of gestational trophoblastic neoplasia.
16217041 Results describe the combined effects of DNA transcription and mRNA translation regulation of ferritin-L synthesis.
15835264 Results describe an hereditary ferritinopathy with a novel mutation (C insertion at nt646-647 in exon 4) in the ferritin light chain gene, resulting in a longer than normal protein.
15727900 Intra-leukocytic hemosiderin inclusions (a complex of ferritin, denatured ferritin and other material) are associated with iron overload and acute infection.
15390032 Adult-onset generalized dystonia due to a mutation in ferritin, light polypeptide.
14615048 Observational study of gene-disease association. (HuGE Navigator)
12746423 autosomal dominant basal ganglia disorder caused by an adenine insertion at position 460-461 of the gene for ferritin light polypeptide (FTL) in a French family
12459518 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12459518 The genetic defects in the FTL gene are unlikely to be a common cause of typical PD, at least in a North America population.
12387819 Analysis of sequence effect on folding efficiency of ferritin heavy and light subunits.
11783942 gene coding and flanking regions were sequenced and examined for mutations that might modulate the iron burden of individuals harboring the common mutant hemochromatosis HFE genotype or cause hemochromatosis independent of mutations in the HFE gene

AA Sequence

MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ      1 - 70
NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK     71 - 140
LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD                                       141 - 175
//

Text Mined References (146)

PMID Year Title
26871431 2016 Expression of Ferritin Light Chain (FTL) Is Elevated in Glioblastoma, and FTL Silencing Inhibits Glioblastoma Cell Proliferation via the GADD45/JNK Pathway.
26611853 2016 Ferritin as an early marker of graft rejection after allogeneic hematopoietic stem cell transplantation in pediatric patients.
26602884 2015 Ferritin is associated with neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26518749 2015 The importance of eukaryotic ferritins in iron handling and cytoprotection.
25976471 2015 Hereditary hemochromatosis type 1 phenotype modifiers in Italian patients. The controversial role of variants in HAMP, BMP2, FTL and SLC40A1 genes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25720123 2015 FTL gene mutation and persistent hyperferritinemia without iron deficiency anemia after phlebotomy.
25447222 2015 A novel neuroferritinopathy mouse model (FTL 498InsTC) shows progressive brain iron dysregulation, morphological signs of early neurodegeneration and motor coordination deficits.
25416956 2014 A proteome-scale map of the human interactome network.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25162662 2014 Genome-wide association study identifies variants in PMS1 associated with serum ferritin in a Chinese population.
24983587 2014 Hereditary hyperferritinemia cataract syndrome as a cause of childhood hyperferritinemia.
24825732 2014 A novel ferritin light chain mutation in neuroferritinopathy with an atypical presentation.
24821637 2014 Cerebrospinal fluid ferritin--unspecific and unsuitable for disease monitoring.
24512320 2014 Ferritin as prognostic marker in multiple myeloma patients undergoing autologous transplantation.
24306042 2014 Hepcidin and ferritin blood level as noninvasive tools for predicting breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24195075 2013 A novel differential predict model based on matrix-assisted laser ionization time-of-flight mass spectrometry and serum ferritin for acute graft-versus-host disease.
24022025 2014 [New mutation in a Spanish family with hereditary hyperferritinemia-cataract syndrome].
23969999 2013 Iron metabolism disturbances in the MCF-7 human breast cancer cells with acquired resistance to doxorubicin and cisplatin.
23940258 2013 Human L-ferritin deficiency is characterized by idiopathic generalized seizures and atypical restless leg syndrome.
23892696 2013 Iron and proinflammatory cytokines in chronic hepatitis C virus infection.
23699174 2013 Transcriptional regulation of the human ferritin gene by coordinated regulation of Nrf2 and protein arginine methyltransferases PRMT1 and PRMT4.
23685131 2013 Ferritin light chain interacts with PEN-2 and affects ?-secretase activity.
23592921 2013 Noncoding variation of the gene for ferritin light chain in hereditary and age-related cataract.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23421845 2013 Novel mutations in the ferritin-L iron-responsive element that only mildly impair IRP binding cause hereditary hyperferritinaemia cataract syndrome.
23381919 2013 Ferritin levels and risk of type 2 diabetes mellitus: an updated systematic review and meta-analysis of prospective evidence.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300545 2012 Elevation in inflammatory serum biomarkers predicts response to trastuzumab-containing therapy.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23119080 2012 Hyperferritinemia and hyperuricemia may be associated with liver function abnormality in obese adolescents.
23029420 2012 Proteins with altered levels in plasma from glioblastoma patients as revealed by iTRAQ-based quantitative proteomic analysis.
22871034 2012 Inflammation associated anemia and ferritin as disease markers in SLE.
22760008 2012 The effect of increased oxidative stress and ferritin in reducing the effectiveness of therapy in chronic hepatitis C patients.
22535864 2012 Two novel mutations in the L ferritin coding sequence associated with benign hyperferritinaemia unmasked by glycosylated ferritin assay.
22359459 2012 Ferritin light chain and squamous cell carcinoma antigen 1 are coreceptors for cellular attachment and entry of hepatitis B virus.
22348978 2012 A mutant light-chain ferritin that causes neurodegeneration has enhanced propensity toward oxidative damage.
22248276 2012 Pretransplant serum ferritin level may be a predictive marker for outcomes in patients having undergone allogeneic hematopoietic stem cell transplantation.
22117997 2011 Oxidative stress levels in myelodysplastic syndrome patients: their relationship to serum ferritin and haemoglobin values.
22020773 2011 Hereditary hyperferritinemia cataract syndrome: clinical, genetic, and laboratory findings in 5 families.
21907119 2011 Hereditary hyperferritinemia-cataract syndrome in two large multigenerational American families.
21696736 2011 Plasma ferritin levels, genetic variations in HFE gene, and coronary heart disease in Chinese: a case-control study.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21541272 2011 Hematologic biomarkers in childhood cataracts.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21139976 2010 Mutation analysis of the ferritin L-chain gene in age-related cataract.
21029774 2011 Iron loading-induced aggregation and reduction of iron incorporation in heteropolymeric ferritin containing a mutant light chain that causes neurodegeneration.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20345975 2010 Toluene diisocyanate (TDI) regulates haem oxygenase-1/ferritin expression: implications for toluene diisocyanate-induced asthma.
20159981 2010 Mutant ferritin L-chains that cause neurodegeneration act in a dominant-negative manner to reduce ferritin iron incorporation.
20088381 [Expression of FTL and FTH genes encoding ferretin subunits in lung and renal carcinomas].
19946888 2010 Defining the membrane proteome of NK cells.
19923220 2010 Unraveling of the E-helices and disruption of 4-fold pores are associated with iron mishandling in a mutant ferritin causing neurodegeneration.
19787796 2009 HFE, SLC40A1, HAMP, HJV, TFR2, and FTL mutations detected by denaturing high-performance liquid chromatography after iron phenotyping and HFE C282Y and H63D genotyping in 785 HEIRS Study participants.
19781644 2010 Oxidative stress and cell death in cells expressing L-ferritin variants causing neuroferritinopathy.
19519778 2009 Abnormal iron metabolism and oxidative stress in mice expressing a mutant form of the ferritin light polypeptide gene.
19318681 2009 Identification of L-ferritin in neuromelanin granules of the human substantia nigra: a targeted proteomics approach.
19254706 2009 Bilateral cataract in a subject carrying a C to A transition in the L ferritin promoter region.
19176363 2009 A new missense mutation in the L ferritin coding sequence associated with elevated levels of glycosylated ferritin in serum and absence of iron overload.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18755684 2008 Iron-mediated aggregation and a localized structural change characterize ferritin from a mutant light chain polypeptide that causes neurodegeneration.
18665827 2008 Serial serum ferritin measurements in untreated HFE C282Y homozygotes in the Hemochromatosis and Iron Overload Screening Study.
18586377 2008 Change in iron transporter expression in human term placenta with different maternal iron status.
18486613 2008 Interactions between PBEF and oxidative stress proteins--a potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
18413574 2008 Neuroferritinopathy in a Japanese family with a duplication in the ferritin light chain gene.
18160403 2008 Ferritin L and H subunits are differentially regulated on a post-transcriptional level.
18061976 2008 The hand arthropathy of hereditary hemochromatosis is strongly associated with iron overload.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17970701 2007 Analysis of ferritin genes in Parkinson disease.
17761032 2007 The association of circulating ferritin with serum concentrations of fibroblast growth factor-23 measured by three commercial assays.
17660802 2007 Prognostic significance of drug-regulated genes in high-grade osteosarcoma.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17459943 2007 Ferritin: a novel mechanism for delivery of iron to the brain and other organs.
17116749 2006 Comparative proteomics of clathrin-coated vesicles.
16858508 2006 Exclusion of mutations in the PRNP, JPH3, TBP, ATN1, CREBBP, POU3F2 and FTL genes as a cause of disease in Portuguese patients with a Huntington-like phenotype.
16822677 2006 Characterization of the l-ferritin variant 460InsA responsible of a hereditary ferritinopathy disorder.
16790936 2006 Structure of human ferritin L chain.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16252260 2006 Ferritin light chain down-modulation generates depigmentation in human metastatic melanoma cells by influencing tyrosinase maturation.
16222695 2005 Differential expression of insulin-like growth factor binding protein 1 and ferritin light polypeptide in gestational trophoblastic neoplasia: combined cDNA suppression subtractive hybridization and microarray study.
16217041 2005 DNA and mRNA elements with complementary responses to hemin, antioxidant inducers, and iron control ferritin-L expression.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16116125 2005 Neuroferritinopathy: missense mutation in FTL causing early-onset bilateral pallidal involvement.
15835264 2005 Hereditary ferritinopathy: a novel mutation, its cellular pathology, and pathogenetic insights.
15727900 Intra-leukocytic hemosiderin inclusions detected as pseudoeosinophils by automated depolarization analysis in a patient with beta-thalassaemia major and immune hemolysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15390032 2005 Adult-onset generalized dystonia due to a mutation in the neuroferritinopathy gene.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
15099026 2004 Intracellular ferritin accumulation in neural and extraneural tissue characterizes a neurodegenerative disease associated with a mutation in the ferritin light polypeptide gene.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615048 2003 Screening for mutations of the ferritin light and heavy genes in Parkinson's disease patients with hyperechogenicity of the substantia nigra.
12746423 2003 Neuroferritinopathy in a French family with late onset dominant dystonia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459518 2002 Screening of ferritin light polypeptide 460-461InsA mutation in Parkinson's disease patients in North America.
12387819 2002 Active human ferritin H/L-hybrid and sequence effect on folding efficiency in Escherichia coli.
12200611 2002 Onset of cataract in early infancy associated with a 32G-->C transition in the iron responsive element of L-ferritin.
12199804 2002 Mutation spectrum in Australian pedigrees with hereditary hyperferritinaemia-cataract syndrome reveals novel and de novo mutations.
12071855 2002 Ferritin binds to light chain of human H-kininogen and inhibits kallikrein-mediated bradykinin release.
11849230 2002 A novel deletion of the L-ferritin iron-responsive element responsible for severe hereditary hyperferritinaemia-cataract syndrome.
11783942 A study of genes that may modulate the expression of hereditary hemochromatosis: transferrin receptor-1, ferroportin, ceruloplasmin, ferritin light and heavy chains, iron regulatory proteins (IRP)-1 and -2, and hepcidin.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11438811 2001 Mutation in the gene encoding ferritin light polypeptide causes dominant adult-onset basal ganglia disease.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10828006 2000 Translational pathophysiology: a novel molecular mechanism of human disease.
10759702 2000 A new mutation (G51C) in the iron-responsive element (IRE) of L-ferritin associated with hyperferritinaemia-cataract syndrome decreases the binding affinity of the mutated IRE for iron-regulatory proteins.
10753629 2000 High level of ferritin light chain mRNA in lens.
10491119 1999 Induction of ferritin and heat shock proteins by prostaglandin A1 in human monocytes. Evidence for transcriptional and post-transcriptional regulation.
9526618 1997 Assignment of ferritin L gene (FTL) to human chromosome band 19q13.3 by in situ hybridization.
9457670 1998 Genetic mapping of the mouse ferritin light chain gene and 11 pseudogenes on 11 mouse chromosomes.
9414313 1998 Hereditary hyperferritinemia-cataract syndrome: two novel mutations in the L-ferritin iron-responsive element.
9414300 1998 A point mutation in the bulge of the iron-responsive element of the L ferritin gene in two families with the hereditary hyperferritinemia-cataract syndrome.
9292547 1997 Hereditary hyperferritinemia-cataract syndrome caused by a 29-base pair deletion in the iron responsive element of ferritin L-subunit gene.
9226182 1997 Hereditary hyperferritinemia-cataract syndrome: relationship between phenotypes and specific mutations in the iron-responsive element of ferritin light-chain mRNA.
9196065 1997 Structure and function of the iron-responsive element from human ferritin L chain mRNA.
9169099 1997 Identification of a ferritin light chain pseudogene near the glycerol kinase locus in Xp21 by cDNA amplification for identification of genomic expressed sequences.
9119260 1997 Pulmonary ferritin: differential effects of hyperoxic lung injury on subunit mRNA levels.
8864140 1996 Differential screening identifies genetic markers of monocyte to macrophage maturation.
8781450 1996 A novel mutation in the iron responsive element of ferritin L-subunit gene as a cause for hereditary hyperferritinemia-cataract syndrome.
8706699 1996 Characterization of the human small-ribosomal-subunit proteins by N-terminal and internal sequencing, and mass spectrometry.
8636399 1996 Increased ferritin gene expression in atherosclerotic lesions.
8630420 1996 Ferritin translation by interleukin-1and interleukin-6: the role of sequences upstream of the start codons of the heavy and light subunit genes.
8554925 1995 The iron-binding protein ferritin is expressed in cells of the osteoblastic lineage in vitro and in vivo.
8041631 1994 Translational enhancement of H-ferritin mRNA by interleukin-1 beta acts through 5' leader sequences distinct from the iron responsive element.
7575610 1995 Negative and positive elements in the promoter region of the human apoferritin L gene.
7493028 1995 Mutation in the iron responsive element of the L ferritin mRNA in a family with dominant hyperferritinaemia and cataract.
7492760 1995 Molecular basis for the recently described hereditary hyperferritinemia-cataract syndrome: a mutation in the iron-responsive element of ferritin L-subunit gene (the "Verona mutation")
6653779 1983 The amino acid sequence of human liver apoferritin.
6572903 1983 Human ferritin gene is assigned to chromosome 19.
3858810 1985 Structure of human ferritin light subunit messenger RNA: comparison with heavy subunit message and functional implications.
3857215 1985 Assignment of human ferritin genes to chromosomes 11 and 19q13.3----19qter.
3840162 1985 Structural and functional relationships of human ferritin H and L chains deduced from cDNA clones.
3754330 1986 Cloning of the gene coding for human L apoferritin.
3291676 1988 The ferritin genes: structure, expression, and regulation.
3023856 1986 Structure and expression of ferritin genes in a human promyelocytic cell line that differentiates in vitro.
3000916 1985 Human ferritin light chain gene sequences mapped to several sorted chromosomes.
2821803 1987 Human ferritin genes: chromosomal assignments and polymorphisms.
659425 1978 On ferritin heterogeneity. Further evidence for heteropolymers.