Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.18
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL      1 - 70
MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH     71 - 140
EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET                               141 - 183
//

Text Mined References (8)

PMID Year Title