Property Summary

NCBI Gene PubMed Count 124
PubMed Score 982.07
PubTator Score 316.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.600 5.3e-07
atypical teratoid / rhabdoid tumor -1.500 3.6e-05
dermatomyositis 1.400 3.2e-04
group 3 medulloblastoma -1.100 1.2e-02
hepatocellular carcinoma -1.100 2.6e-06
lung cancer -1.200 1.6e-03
medulloblastoma, large-cell -3.300 4.5e-07
Multiple myeloma 1.427 5.9e-04
non-small cell lung cancer -1.145 2.7e-16
ovarian cancer -1.700 6.5e-04
psoriasis 1.700 3.5e-05
subependymal giant cell astrocytoma 1.383 4.4e-03
ulcerative colitis -1.200 3.6e-05
Waldenstrons macroglobulinemia 1.218 2.6e-02

PDB (36)

Gene RIF (74)

AA Sequence

MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL      1 - 70
MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN     71 - 140
EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES                               141 - 183
//

Text Mined References (132)

PMID Year Title