Property Summary

NCBI Gene PubMed Count 116
PubMed Score 924.46
PubTator Score 316.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.100 2.6e-06
Waldenstrons macroglobulinemia 1.218 2.6e-02
Multiple myeloma 1.427 5.9e-04
malignant mesothelioma -1.600 5.3e-07
psoriasis 1.700 3.5e-05
group 4 medulloblastoma -2.400 1.7e-06
atypical teratoid / rhabdoid tumor -1.500 3.6e-05
medulloblastoma, large-cell -3.300 4.5e-07
non-small cell lung cancer -1.145 2.7e-16
lung cancer -1.600 2.1e-05
subependymal giant cell astrocytoma 1.383 4.4e-03
ulcerative colitis -1.200 3.6e-05
ovarian cancer -1.700 6.5e-04
dermatomyositis 1.400 3.2e-04

Synonym

Accession P02794 B3KNR5 Q3KRA8 Q3SWW1 Ferritin H subunit
Symbols FHC
FTH
HFE5
PLIF
FTHL6
PIG15

Gene

PANTHER Protein Class (1)

PDB

1FHA   2CEI   2CHI   2CIH   2CLU   2CN6   2CN7   2FHA   2IU2   2Z6M   3AJO   3AJP   3AJQ   3ERZ   3ES3   4DYX   4DYY   4DYZ   4DZ0   4OYN   4Y08   4YKH   4ZJK   5CMQ   5CMR  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (67)

PMID Text
26886577 Human FTH1 is a general pro-survival sequence.
26602884 Ferritin light chain and ferritin heavy chain are required for the neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26540556 H-ferritin tissue expression and the number of CD68+/H-ferritin+ cells were increased in the lymph nodes of adult-onset Still's disease patients, and these results correlated significantly with disease severity
26518749 Studies indicate that the the best characterized cytosolic ferritins in mammals are encoded by two genes, FTH and FTL, with four exons and similar structures.
26327381 Stopped-flow kinetics assays revealed that human H ferritin has different levels of activity compared with its R. catesbeiana counterpart
25448225 The goals of this study were to evaluate the multilineage differentiation ability of human mesenchymal stem cells expressing an MRI reporter, human ferritin heavy chain (FTH).
25265351 High ferritin expression is associated with malignant phenotype of breast cancer.
25134646 Significant differences were seen in the levels of serum iron and hepcidin but not ferritin between the -582A>G hepcidin polymorphism genotypes.
24742827 high cytoplasmic FTH1 was associated with favorable prognosis whereas nuclear FTH1 staining was associated with adverse prognosis in triple negative breast cancer
24512320 Data suggest that iron-independent effects of ferritin in myeloma should be prospectively investigated in preclinical and clinical studies.
24446242 High serum ferritin levels are associated with pancreatic cancer.
24124891 FTH provides metabolic adaptation to tissue Fe overload. [Review]
24113184 HIV-1 gp120 upregulates the expression of ferritin heavy chain in astrocytes
24098686 Elevated serum ferritin level is associated with the incident type 2 diabetes in healthy Korean men.
24066693 Tumor necrosis factor-alpha attenuates starvation-induced apoptosis through upregulation of ferritin heavy chain in hepatocellular carcinoma cells.
24053984 Children with autism spectrum disorders have significantly lower ferritin levels compared with controls and higher levels of sleep fragmentation and periodic limb movements.
23892696 Data indicate that serum highest TNF-alpha and IL-6 and higher ferritin are among those with intense steatosis.
23874603 HIV-1 gp120 upregulates the expression of ferritin heavy chain in astrocytes
23611361 In normal bone marrow, ferritin H antibody stained early erythroid precursors and macrophages. In leukemic bone marrow, ferritin H was selectively expressed in erythroid blasts (M6), whereas all other blasts were negative.
23344859 The present study provides information about the metal binding sites of human H-chain ferritin and the pathway of ferrous ions (Fe2+) from the cytoplasm to the interior of the ferritin nanocage.
23324584 Serum ferritin levels in infectious diseases was lower than those in hematologic diseases.
23119080 Data indicate that ferritin levels and hyperuricemia are two independently significant factors associated with alanine aminotransferase (ALT) elevation among obese adolescents.
23079850 Traumatic brain injury upregulates ferritin-heavy-chain in pericontusional cortex.
23079089 Increased levels of serum ferritin are adversely associated with cardiac function following myocardial infarction treated with percutaneous coronary intervention.
22843505 H-ferritin overexpression promotes radiation-induced leukemia/lymphoma.
22768652 Elevated serum ferrin in infants is associated with congenital hypothyroidism.
22760008 Increased levels of ferritin and decreased total antioxidant status indicated increasing inflammation in chronic hepatitis C.
22676252 The hepcidin:ferritin ratio is reduced in relation to increasing fibrosis in chronic liver disease.
22443280 Induction of ferritin heavy chain expression results in severe inhibition of apoB-100 secretion from hepatoma cells during HCV infection.
22426960 Survivin inhibition by an interacting recombinant peptide, derived from the human ferritin heavy chain, impedes tumor cell growth
22212821 To study whether the human ferritin heavy chain (FTH1) can be expressed in Hansenula polymorpha, we integrated an expression cassette for FTH1, analyzed the protein expression, and also designed a FTH1-PTH fusion protein.
22117997 There was a positive correlation between reactive oxygen species levels and serum ferritin levels in myelodysplastic syndrome patients
22043922 H ferritin silenced human metastatic melanoma cells are characterized by a decreased growth activity, a reduced invasiveness, and a reduced cell adhesion capability.
22020807 Data provide useful insights into biomineralization of ferritin under in vivo fever conditions as well as in biomimetic synthesis of nanomaterials using ferritin.
21573799 FTH1 can inhibit the activation of the JNK signaling pathway and can bind to Daxx, inhibiting Daxx-mediated apoptosis.
21555518 FTH1 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
21413929 results showed the association of secreted IL-10, FHC and iron homoeostasis in Chlamydia trachomatis-infected HeLa-229 cells
21385903 Results illustrate how silencing H-ferritin can effectively sensitize tumors to chemotherapy.
21029774 The study shows the facile assembly of mutant FTL and FTH1 subunits into soluble ferritin heteropolymers, but their ability to incorporate iron was significantly reduced relative to wild-type-FTL/FTH1 heteropolymers.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20705053 transit-site-deficient mutants of human H ferritin, E140A and E140Q, were prepared and their iron oxidation kinetics was analyzed.
20390345 High ferritin is associated with breast cancer.
20133674 TfR1 accounts for most, if not all, of the binding of HFt to mitogen-activated T and B cells, circulating reticulocytes, and all cell lines that we have studied.
20110920 This study suggests that there is a relationship between HR and ferritin level, which may be associated with an increased level of oxidative stress.
20088381 Expression of FTL and FTH genes encoding ferretin subunits in lung and renal carcinomas
19855093 Triple A patients (with known AAAS mutations) lack nuclear FTH1, suggesting that the nuclear translocation of FTH1 is defective.
19821764 Inhibition of osteoblast activity, mineralization, and specific gene expression is attributed to the ferroxidase activity of ferritin.
19539693 human C48-placenta immunoregulatory factor is an effective, single therapeutic agent enabling allogeneic, nonmanipulated murine bone marrow transplantation
19126685 ferritin binds to HKa (cleaved high molecular weight kininogen) with high affinity (K(d) 13 nM). Further, ferritin antagonizes the antiangiogenic effects of HKa, enhancing the migration, assembly, and survival of HKa-treated endothelial cells
19023418 C. albicans can exploit iron from host ferritin via morphology dependent binding through Als3
18621011 HIV-1 gp120 upregulates the expression of ferritin heavy chain in astrocytes
18160403 FTL and FTH subunits respond independently to cellular iron concentrations
17970701 Observational study of gene-disease association. (HuGE Navigator)
17761032 We have detected a significant inverse correlation of -0.565 (P<0.0001) between serum ferritin when <50 microg/L and FGF-23.
17702748 H ferritin regulates folate metabolism through its internal ribosome entry site
17070541 We report the crystallographic structures of four human H apoferritin variants at a resolution of up to 1.5 Angstrom. Crystal derivatives using Zn(II) as redox-stable alternative for Fe(II), allows us to characterize the different metal-binding sites.
15967798 H-ferritin mRNA, IL-1beta, and poly(C)-binding proteins may have roles in ferritin translation and iron homeostasis in human liver
15755449 Data reveal striking differences in iron oxidation and hydrolysis chemistry between human mitochondrial ferritin and human H-chain ferritin despite their similar diiron ferroxidase centers
15727900 Intra-leukocytic hemosiderin inclusions (a complex of ferritin, denatured ferritin and other material) are associated with iron overload and acute infection.
14998975 Placenta immunomodulatory ferritin (PLIF) plays a major role in placentation and embryonic growth.
14615048 Observational study of gene-disease association. (HuGE Navigator)
12435735 FTH expression is mediated by Nrf2 in response to xenobiotics and cancer chemopreventive dithiolethiones
12387819 Analysis of sequence effect on folding efficiency of ferritin heavy and light subunits.
11988076 mu-1,2-Peroxobridged di-iron(III) dimer formation in human H-chain ferritin
11964300 activates regulatory T cells by induction of changes in dendritic cells
11903046 An alternative model of H ferritin promoter transactivation by c-Jun (H ferritin, also called isoferritin)
11783942 gene coding and flanking regions were sequenced and examined for mutations that might modulate the iron burden of individuals harboring the common mutant hemochromatosis HFE genotype or cause hemochromatosis independent of mutations in the HFE gene

AA Sequence

MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL      1 - 70
MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN     71 - 140
EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES                               141 - 183
//

Text Mined References (124)

PMID Year Title
26886577 2016 Identification of human ferritin, heavy polypeptide 1 (FTH1) and yeast RGI1 (YER067W) as pro-survival sequences that counteract the effects of Bax and copper in Saccharomyces cerevisiae.
26602884 2015 Ferritin is associated with neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26540556 2016 The CD68(+)/H-ferritin(+) cells colonize the lymph nodes of the patients with adult onset Still's disease and are associated with increased extracellular level of H-ferritin in the same tissue: correlation with disease severity and implication for pathogenesis.
26518749 2015 The importance of eukaryotic ferritins in iron handling and cytoprotection.
26327381 2015 Iron binding to human heavy-chain ferritin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25448225 2015 Noninvasive MRI and multilineage differentiation capability of ferritin-transduced human mesenchymal stem cells.
25416956 2014 A proteome-scale map of the human interactome network.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25265351 2014 Significance of ferritin expression in formation of malignant phenotype of human breast cancer cells.
25134646 2014 Impact of hepcidin antimicrobial peptide on iron overload in tuberculosis patients.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24742827 2014 Ferritin heavy chain in triple negative breast cancer: a favorable prognostic marker that relates to a cluster of differentiation 8 positive (CD8+) effector T-cell response.
24512320 2014 Ferritin as prognostic marker in multiple myeloma patients undergoing autologous transplantation.
24446242 2014 Elevation in multiple serum inflammatory biomarkers predicts survival of pancreatic cancer patients with inoperable disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24124891 2014 Coupling heme and iron metabolism via ferritin H chain.
24098686 2013 Elevated serum ferritin level is associated with the incident type 2 diabetes in healthy Korean men: a 4 year longitudinal study.
24066693 2013 Tumor necrosis factor-? attenuates starvation-induced apoptosis through upregulation of ferritin heavy chain in hepatocellular carcinoma cells.
24053984 2013 Relationship of serum ferritin levels to sleep fragmentation and periodic limb movements of sleep on polysomnography in autism spectrum disorders.
23892696 2013 Iron and proinflammatory cytokines in chronic hepatitis C virus infection.
23611361 2013 Ferritin H is a novel marker of early erythroid precursors and macrophages.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344859 2013 Metal binding sites of human H-chain ferritin and iron transport mechanism to the ferroxidase sites: a molecular dynamics simulation study.
23324584 2013 Diagnostic use of serum ferritin levels to differentiate infectious and noninfectious diseases in patients with fever of unknown origin.
23119080 2012 Hyperferritinemia and hyperuricemia may be associated with liver function abnormality in obese adolescents.
23079850 2013 Increased expression of ferritin in cerebral cortex after human traumatic brain injury.
23079089 2013 Serum ferritin levels adversely affect cardiac function in patients with ST-elevation myocardial infarction who underwent successful percutaneous coronary intervention.
22843505 2012 H-ferritin overexpression promotes radiation-induced leukemia/lymphoma in mice.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22768652 2012 Elevated serum ferritin and soluble transferrin receptor in infants with congenital hypothyroidism.
22760008 2012 The effect of increased oxidative stress and ferritin in reducing the effectiveness of therapy in chronic hepatitis C patients.
22676252 2012 The serum hepcidin:ferritin ratio is a potential biomarker for cirrhosis.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
22443280 2012 Ferritin heavy chain is the host factor responsible for HCV-induced inhibition of apoB-100 production and is required for efficient viral infection.
22426960 2012 Survivin inhibition by an interacting recombinant peptide, derived from the human ferritin heavy chain, impedes tumor cell growth.
22212821 2012 The use of highly expressed FTH1 as carrier protein for cytosolic targeting in Hansenula polymorpha.
22117997 2011 Oxidative stress levels in myelodysplastic syndrome patients: their relationship to serum ferritin and haemoglobin values.
22043922 2011 H ferritin gene silencing in a human metastatic melanoma cell line: a proteomic analysis.
22020807 2012 The influence of reaction temperature on biomineralization of ferrihydrite cores in human H-ferritin.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21573799 2012 FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21413929 2011 Ferritin heavy chain-mediated iron homoeostasis regulates expression of IL-10 in Chlamydia trachomatis-infected HeLa cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385903 2011 Heavy chain ferritin siRNA delivered by cationic liposomes increases sensitivity of cancer cells to chemotherapeutic agents.
21269460 2011 Initial characterization of the human central proteome.
21029774 2011 Iron loading-induced aggregation and reduction of iron incorporation in heteropolymeric ferritin containing a mutant light chain that causes neurodegeneration.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20705053 2010 The universal mechanism for iron translocation to the ferroxidase site in ferritin, which is mediated by the well conserved transit site.
20390345 2011 Role of ferritin alterations in human breast cancer cells.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20133674 2010 Binding and uptake of H-ferritin are mediated by human transferrin receptor-1.
20110920 2010 Serum ferritin levels correlate with hypertensive retinopathy.
20088381 [Expression of FTL and FTH genes encoding ferretin subunits in lung and renal carcinomas].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19855093 2009 Deficiency of ferritin heavy-chain nuclear import in triple a syndrome implies nuclear oxidative damage as the primary disease mechanism.
19821764 2010 Ferritin ferroxidase activity: a potent inhibitor of osteogenesis.
19539693 2009 A proof of concept study: human C48-placenta immunoregulatory factor is an effective, single therapeutic agent enabling allogeneic, nonmanipulated murine bone marrow transplantation.
19126685 2009 Regulatory effects of ferritin on angiogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19023418 2008 the hyphal-associated adhesin and invasin Als3 of Candida albicans mediates iron acquisition from host ferritin.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18160403 2008 Ferritin L and H subunits are differentially regulated on a post-transcriptional level.
17970701 2007 Analysis of ferritin genes in Parkinson disease.
17761032 2007 The association of circulating ferritin with serum concentrations of fibroblast growth factor-23 measured by three commercial assays.
17702748 2007 A ferritin-responsive internal ribosome entry site regulates folate metabolism.
17116749 2006 Comparative proteomics of clathrin-coated vesicles.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17070541 2007 High-resolution X-ray structures of human apoferritin H-chain mutants correlated with their activity and metal-binding sites.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15967798 2005 The acute box cis-element in human heavy ferritin mRNA 5'-untranslated region is a unique translation enhancer that binds poly(C)-binding proteins.
15755449 2005 Unique iron binding and oxidation properties of human mitochondrial ferritin: a comparative analysis with Human H-chain ferritin.
15727900 Intra-leukocytic hemosiderin inclusions detected as pseudoeosinophils by automated depolarization analysis in a patient with beta-thalassaemia major and immune hemolysis.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14998975 2004 Blocking of the placental immune-modulatory ferritin activates Th1 type cytokines and affects placenta development, fetal growth and the pregnancy outcome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615048 2003 Screening for mutations of the ferritin light and heavy genes in Parkinson's disease patients with hyperechogenicity of the substantia nigra.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435735 2003 Nrf2 mediates the induction of ferritin H in response to xenobiotics and cancer chemopreventive dithiolethiones.
12387819 2002 Active human ferritin H/L-hybrid and sequence effect on folding efficiency in Escherichia coli.
11964300 2002 Heavy chain ferritin activates regulatory T cells by induction of changes in dendritic cells.
11903046 2002 An alternative model of H ferritin promoter transactivation by c-Jun.
11821435 2002 PLIF, a novel human ferritin subunit from placenta with immunosuppressive activity.
11783942 A study of genes that may modulate the expression of hereditary hemochromatosis: transferrin receptor-1, ferroportin, ceruloplasmin, ferritin light and heavy chains, iron regulatory proteins (IRP)-1 and -2, and hepcidin.
11389486 2001 A mutation, in the iron-responsive element of H ferritin mRNA, causing autosomal dominant iron overload.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10855793 2000 Characterization of trinucleotide- and tandem repeat-containing transcripts obtained from human spinal cord cDNA library by high-density filter hybridization.
10833524 2000 Overexpression of wild type and mutated human ferritin H-chain in HeLa cells: in vivo role of ferritin ferroxidase activity.
9924025 1999 Coordinated regulation of iron-controlling genes, H-ferritin and IRP2, by c-MYC.
9581019 1998 Iron metabolism and human ferritin heavy chain cDNA from adult brain with an elongated untranslated region: new findings and insights.
9159481 1997 Comparison of the three-dimensional structures of recombinant human H and horse L ferritins at high resolution.
8915895 1996 Differential expression of the heavy-chain ferritin gene in non-adhered and adhered oligodendrocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8630420 1996 Ferritin translation by interleukin-1and interleukin-6: the role of sequences upstream of the start codons of the heavy and light subunit genes.
7931301 1994 Hypoxia specifically and reversibly induces the synthesis of ferritin in oligodendrocytes and human oligodendrogliomas.
7916709 1993 Sequence of a cDNA encoding the ferritin H-chain from an 11-week-old human fetal brain.
7821789 1994 Construction of a human full-length cDNA bank.
7616228 1995 A quantitative analysis of isoferritins in select regions of aged, parkinsonian, and Alzheimer's diseased brains.
7504084 1993 Differential processing of the ferritin heavy chain mRNA in human liver and adult human brain.
6653779 1983 The amino acid sequence of human liver apoferritin.
6589621 1984 Isolation and characterization of a cDNA clone for human ferritin heavy chain.
6323167 1984 Cloning and sequencing of a full length cDNA coding for a human apoferritin H chain: evidence for a multigene family.
3858810 1985 Structure of human ferritin light subunit messenger RNA: comparison with heavy subunit message and functional implications.
3857215 1985 Assignment of human ferritin genes to chromosomes 11 and 19q13.3----19qter.
3840162 1985 Structural and functional relationships of human ferritin H and L chains deduced from cDNA clones.
3685996 1987 Identification of the iron-responsive element for the translational regulation of human ferritin mRNA.
3023856 1986 Structure and expression of ferritin genes in a human promyelocytic cell line that differentiates in vitro.
3020541 1986 Cloning, characterization, expression, and chromosomal localization of a human ferritin heavy-chain gene.
3003694 1986 Structure of gene and pseudogenes of human apoferritin H.
1992356 1991 Solving the structure of human H ferritin by genetically engineering intermolecular crystal contacts.
659425 1978 On ferritin heterogeneity. Further evidence for heteropolymers.