Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Osteoporosis 259
Schizophrenia 503

Expression

Synonym

Accession E5RQL4
Symbols FONG

Gene

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
26492493 rs10203122 in FTCDNL1 is associated with a susceptibility to osteoporosis.
23303384 results suggest that Japanese subjects homozygous for the risk alleles of rs7605378 in FONG and rs12673629 in THSD7A have a significantly higher risk of vertebral fracture
21573128 A single nucleotide polymorphism (SNP), rs7605378 associated with osteoporosis, was identified, in a previously unknown gene on chromosome 2q33.1, FONG.

AA Sequence

MSSSRVGLRLAACLLNVSEAGRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYKRSVITIATSVDKL      1 - 70
GLAEDLVLHVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTRRDFSALQPDLGAAPSQRCGLTGSEHGFCF     71 - 140
ALFFFFF                                                                   141 - 147
//

Text Mined References (7)

PMID Year Title
26492493 2015 Association Study between the FTCDNL1 (FONG) and Susceptibility to Osteoporosis.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23303384 2013 Association of the formiminotransferase N-terminal sub-domain containing gene and thrombospondin, type 1, domain-containing 7A gene with the prevalence of vertebral fracture in 2427 consecutive autopsy cases.
21573128 2011 Common variants in a novel gene, FONG on chromosome 2q33.1 confer risk of osteoporosis in Japanese.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.