Property Summary

NCBI Gene PubMed Count 21
PubMed Score 170.00
PubTator Score 34.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -1.482 9.0e-03
pancreatic ductal adenocarcinoma liver m... -1.996 4.2e-03

Gene RIF (11)

AA Sequence

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVAS      1 - 70
RLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPA     71 - 140
IRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGK    141 - 210
DQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLD    211 - 280
AAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGAR    281 - 350
SAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYL    351 - 420
EAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMG    421 - 490
VFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE                       491 - 541
//

Text Mined References (24)

PMID Year Title