Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.32
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.800 1.8e-08
glioblastoma -4.600 4.5e-05
oligodendroglioma -2.000 1.0e-08
ependymoma -1.800 1.5e-02
atypical teratoid / rhabdoid tumor -3.000 5.4e-03
adult high grade glioma -5.000 1.6e-07
pilocytic astrocytoma -4.700 4.4e-09
sonic hedgehog group medulloblastoma -3.400 3.4e-05
non primary Sjogren syndrome sicca -1.200 2.3e-02
subependymal giant cell astrocytoma -4.734 1.2e-02

 GO Function (1)

 GO Component (1)

Gene RIF (3)

PMID Text
26045876 FSTL5 plays a suppressive role in hepatocellular carcinoma. Down-regulation of FSTL5 could promote growth and survival of HCC cells by activation of Wnt/beta-catenin signaling.
21911727 FSTL5 expression denoted a dismal prognosis both within and across medulloblastoma subgroups.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCENKYC      1 - 70
GLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNEDCFFKGDKC     71 - 140
KTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDINELTQVIKQEELG    141 - 210
KDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPI    211 - 280
IWKRNNIILNNLDLEDINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQ    281 - 350
AREPGVTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG    351 - 420
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLGFQDEVC    421 - 490
PKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLS    491 - 560
WGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKID    561 - 630
LETMSYIKTINLKDYKCVPQSLAYTHLGGYYFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVS    631 - 700
PDGHYLVSINDVKGLVRVQYITIRGEIQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVE    701 - 770
LSSGKVKMIKSLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT    771 - 840
VIWVGDA                                                                   841 - 847
//

Text Mined References (16)

PMID Year Title
26045876 2015 Down-regulated FSTL5 promotes cell proliferation and survival by affecting Wnt/?-catenin signaling in hepatocellular carcinoma.
25023989 2014 A novel colorectal cancer risk locus at 4q32.2 identified from an international genome-wide association study.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
21911727 2011 FSTL5 is a marker of poor prognosis in non-WNT/non-SHH medulloblastoma.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15527507 2004 An enigmatic fourth runt domain gene in the fugu genome: ancestral gene loss versus accelerated evolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8358434 1993 3,400 new expressed sequence tags identify diversity of transcripts in human brain.