Property Summary

NCBI Gene PubMed Count 40
PubMed Score 93.87
PubTator Score 50.14

Knowledge Summary

Patent

No data available

Expression

 IMPC Phenotype (1)

Gene RIF (26)

PMID Text
26903060 Children with chronic heart failure group had a significantly higher serum level of FSTL1 than the control group.
26375005 data suggest that the loss of epicardial FSTL1 is a maladaptive response to injury, and that its restoration would be an effective way to reverse myocardial death and remodelling following myocardial infarction in humans
26365350 provide mechanistic insight into the regulation of erythropoiesis by FSTL1 signaling and lay a foundation for exploring FSTL1 signaling as a therapeutic target for anemia
26355153 administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation
25888873 FSTL1 is elevated in patients with osteoarthritis and involved in the progression of synovial inflammation.
25584011 Fstl1 is induced in response to lung injury and promotes the accumulation of myofibroblasts and subsequent fibrosis. These data suggest that Fstl1 may serve as a novel therapeutic target for treatment of progressive lung fibrosis.
24838142 FSTL1 is elevated in various inflammatory conditions and decreased during the course of treatment. FSTL1 may therefore be a valuable biomarker for such diseases.
24470197 These results suggest that FSTL-1 may act on the NLRP3 inflammasome to promote IL-1beta secretion from monocytes/macrophages.
24347831 FSTL1 is a potential mediator of inflammation and insulin resistance in obesity.
23419164 results demonstrated that follistatin-like protein 1 (Fstl1) is expressed and secreted by human myotubes and plasma Fstl1 levels are increased after exercise
23395958 A clear inverse correlation between the expression pattern of FSTL1 (pro-migratory) and miR-198 (anti-migratory) highlights the importance of this regulatory switch in controlling context-specific gene expression to orchestrate wound re-epithelialization.
22265692 FRP has the function of evoking innate immune responses as one of the endogenous TLR4 agonists.
22117761 Data show that the serum and synovial fluid (SF) FSTL1 levels were markedly higher in female OA patients than in males.
21718795 These data suggest that Cx43 inhibits the invasion and metastasis of pulmonary giant cell carcinoma cells by modulating the secretion of FSTL1, which is regulated by histone acetylation.
21303509 Elevated FSTL1 levels reflect not only joint diseases but also inflammation and tissue degradation in systemic autoimmune diseases.
20860622 DIP2A could be a cell-surface receptor protein and mediate a FOS down-regulation signal of FRP. FRP bound to DIP2A and CD14, and also with proteins of the TGF-beta superfamily
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19109154 FSTL-1 is overexpressed by 2-3-fold in synovial tissues of rheumatoid arthritis patients compared with control synovium obtained from subjects undergoing knee arthroscopic anterior cruciate ligament repair.
18796737 Cell migration and invasion assays demonstrated a remarkably lower cell migration and invasion capability in FSTL1-transfected cells in relation to downregulation of matrix metallopeptidase-2
18718903 Fstl1 is a secreted muscle protein or myokine that can function to promote endothelial cell function and stimulates revascularization in response to ischemic insult through its ability to activate Akt-eNOS signaling
18617621 Elevated myocardial expression of FST-like genes is a feature of heart failure and may be linked to both disease severity and mechanisms underlying recovery.
16256108 TSC-36 can be induced in VSMCs (vascular smooth muscle cells) and inhibits VSMCs proliferation in vitro and in vivo.
15638044 Observational study of gene-disease association. (HuGE Navigator)
15638044 FRP mRNA is overexpressed in rheumatoid arthritis synovium, the product of which exerts inhibitory activity on synovial cell growth
15296481 Whilst follistatin expression is unchanged, follistatin-related gene is down-regulated in endometrial carcinoma.

AA Sequence

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG      1 - 70
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS     71 - 140
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD    141 - 210
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE    211 - 280
EEMTRYVQELQKHQETAEKTKRVSTKEI                                              281 - 308
//

Text Mined References (44)

PMID Year Title
26903060 2016 [Change in serum follistatin-like protein 1 and its clinical significance in children with chronic heart failure].
26375005 2015 Epicardial FSTL1 reconstitution regenerates the adult mammalian heart.
26365350 2015 Follistatin-like 1 attenuates differentiation and survival of erythroid cells through Smad2/3 signaling.
26355153 2015 Fstl1 Promotes Asthmatic Airway Remodeling by Inducing Oncostatin M.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25888873 2015 The involvement of follistatin-like protein 1 in osteoarthritis by elevating NF-?B-mediated inflammatory cytokines and enhancing fibroblast like synoviocyte proliferation.
25584011 2015 Blocking follistatin-like 1 attenuates bleomycin-induced pulmonary fibrosis in mice.
25416956 2014 A proteome-scale map of the human interactome network.
24838142 2014 Follistatin-like protein 1 and its role in inflammation and inflammatory diseases.
24470197 2014 Follistatin-like protein 1 enhances NLRP3 inflammasome-mediated IL-1? secretion from monocytes and macrophages.
24347831 2013 Follistatin-like 1: a potential mediator of inflammation in obesity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23419164 2013 Regulation of follistatin-like protein 1 expression and secretion in primary human skeletal muscle cells.
23395958 2013 'See-saw' expression of microRNA-198 and FSTL1 from a single transcript in wound healing.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22265692 2012 Follistatin-related protein/follistatin-like 1 evokes an innate immune response via CD14 and toll-like receptor 4.
22117761 2011 Follistatin-like protein 1: a serum biochemical marker reflecting the severity of joint damage in patients with osteoarthritis.
21718795 2011 Suppression of lung cancer cell invasion and metastasis by connexin43 involves the secretion of follistatin-like 1 mediated via histone acetylation.
21303509 2011 Follistatin-like protein 1 is elevated in systemic autoimmune diseases and correlated with disease activity in patients with rheumatoid arthritis.
21269460 2011 Initial characterization of the human central proteome.
20860622 2010 DIP2 disco-interacting protein 2 homolog A (Drosophila) is a candidate receptor for follistatin-related protein/follistatin-like 1--analysis of their binding with TGF-? superfamily proteins.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19109154 2009 Follistatin-like protein 1 promotes arthritis by up-regulating IFN-gamma.
19060904 2009 An empirical framework for binary interactome mapping.
18796737 2009 Tumor suppressor effect of follistatin-like 1 in ovarian and endometrial carcinogenesis: a differential expression and functional analysis.
18718903 2008 Follistatin-like 1, a secreted muscle protein, promotes endothelial cell function and revascularization in ischemic tissue through a nitric-oxide synthase-dependent mechanism.
18617621 2008 Expression of follistatin-related genes is altered in heart failure.
17029022 2006 Bone morphogenetic proteins and their antagonists.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16256108 2006 TSC-36/FRP inhibits vascular smooth muscle cell proliferation and migration.
15638044 Follistatin-related protein gene (FRP) is expressed in the synovial tissues of rheumatoid arthritis, but its polymorphisms are not associated with genetic susceptibility.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15296481 2004 Follistatin-related gene expression, but not follistatin expression, is decreased in human endometrial adenocarcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11150499 2000 cDNA micro array identification of a gene differentially expressed in adenovirus type 5- versus type 12-transformed cells.
9786430 1998 Cloning of follistatin-related protein as a novel autoantigen in systemic rheumatic diseases.
7957230 1994 Characterization of a rat C6 glioma-secreted follistatin-related protein (FRP). Cloning and sequence of the human homologue.