Property Summary

NCBI Gene PubMed Count 9
PubMed Score 36.95
PubTator Score 10.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
breast carcinoma 1638 1.0e-15
ependymoma 4679 7.4e-12
Breast cancer 3578 3.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.200 3.1e-03
breast carcinoma 1.400 1.0e-15
ependymoma 2.100 7.4e-12

Synonym

Accession Q8NA03 Q6X2C8 Q86Y89
Symbols HSD10

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPGSFKVDTASNLNSGKEDHSESSNTENRRTSND      1 - 70
DKQESCSEKIKLAEEGSDEDLDLVQHQIISECSDEPKLKELDSQLQDAIQKMKKLDKILAKKQRREKEIK     71 - 140
KQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTAVSEETVGPSHEEEDTFSSVFHTQIPPEEYE    141 - 210
MQMQKLNKDFTCDVERNESLIKSGKKPFSNTEKIELRGKHNQDFIKRNIELAKESRNPVVMVDREKKRLV    211 - 280
ELLKDLDEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQ    281 - 350
KPDRDGERNMEVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENVLESTSCLSEEQLKCLLDECILKQK    351 - 420
SIIKLSSERKKEDIEDVTPVFPQLSRSIISKLLNESETKVQKTEVEDADMLESEECEASKGYYLTKALTG    421 - 490
HNMSEALVTEAENMKCLQFSKDVIISDTKDYFMSKTLGIGRLKRPSFLDDPLYGISVSLSSEDQHLKLSS    491 - 560
PENTIADEQETKDAAEECKEP                                                     561 - 581
//

Text Mined References (10)

PMID Year Title