Property Summary

NCBI Gene PubMed Count 79
PubMed Score 147.18
PubTator Score 290.66

Knowledge Summary

Patent

No data available

 HCA RNA Cell Line (1)

Gene RIF (49)

PMID Text
25052309 The FSHB -211G>T variant attenuates serum FSH levels in the supraphysiological gonadotropin setting of Klinefelter syndrome
24718625 3 known FSH-action modulating SNPs (FSHB -211G/T; FSHR -29G/A, c.2039 A/G)explained together 2.3%, 1.4%, 1.0 and 1.1% of the measured variance in serum FSH, Inhibin B, testosterone and total testes volume, respectively.
23850305 The combined effect of FSHB GG+FSHR AA may potentiate the FSH pathway, which increases serum levels of FSH and reduces antimullerian hormone in health girls.
23766128 Data suggest that low serum FSH levels in men with an SNP in promoter region of FSHB (-211G/T) result from reduced binding of LHX3 (LIM homeobox 3) to FSHB promoter/response element and down-regulation of FSHB transcription in gonadotrophs.
23504007 Serum FSH levels are affected by the combination of genetic polymorphisms in FSHR and FSHB
23426431 activin-regulated transcription mediated by forkhead box L2 [review]
23423746 Data indicate that neither serum inhibin B nor follicle-stimulating hormone (FSH) is a suitable surrogate for determination of sperm concentration in a semen sample.
23380184 Ser680 genotype for FSHR is a factor of relative resistance to FSH stimulation resulting in slightly higher FSH serum levels, thus leading to a prolonged duration of the menstrual cycle.
23160221 Both estradiol and progesterone uniquely modulate basal and GnRH-stimulated gonadotropin promoters without affecting cell growth.
23118424 Phenotypic consequences of FSHB -211G-->T on the hypothalamic-pituitary-ovarian axis in women.
23015653 Negative fetal FSH/LH regulation in late pregnancy is associated with declined kisspeptin/KISS1R expression in the tuberal hypothalamus.
22791757 In the proposed model of the combined effects, FSHB -211G>T acts strongly on male reproductive parameters, whereas the FSHR 2039A>G effects were approximately 2-3 times smaller.
22000911 FSHB -211 TT genotype might represent a novel treatable form of male infertility characterized by severe spermatogenic impairment and low or inappropriately normal FSH plasma levels.
21733993 We showed for the first time that genetically determined low FSH may have wider downstream effects on the male reproductive system, including impaired testes development, altered testicular hormone levels and affected male reproductive potential.
21720063 [review] A middle-aged male with feminizing adrenocortical (ACC) tumor shows delayed response of luteinizing hormone and poor response of FSH to gonadotropin-releasing hormone administration.
21149714 Findings demonstrate that FSH has dose-dependent anabolic effects on bone via an ovary-dependent mechanism.
20869425 Polymorphisms in the 5'-flanking regions of FSHbeta and luteinizing hormone (LH)beta genes are probably related to the puberty onset time of Chinese Han girls.
20814826 FSH dysfunction due to a less acidic isoform pattern through hypoglycosylation is not a key mechanism of primary ovarian insufficiency in classic galactosemia
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20488225 the genomic and genetic context of the FSHB and the LHB/CGB genes largely affects the profile of the hormone production
20233786 FoxL2 plays a key role in activin induction of the FSHbeta gene, by binding to sites conserved across multiple species.
19897680 This genetic marker may have clinical significance in molecular diagnostics of male reproductive success.
19897680 Observational study of gene-disease association. (HuGE Navigator)
19734592 The level of serum FSH may be related to bone loss and the occurrence of osteoporosis in Chinese women.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19324968 A novel role for FOXL2 in activin A-regulated Fshb transcription.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19054012 Ghrelin suppresses the secretion of FSH in humans.
18653705 Activator protein-1 and smad proteins synergistically regulate human follicle-stimulating hormone beta-promoter activity.
18567894 A polymorphism within the FSHB gene is associated with serum FSH levels in men.
18567894 Observational study of gene-disease association. (HuGE Navigator)
18402948 Case Report: Isolated FSH deficiency without mutation of the FSHbeta gene and successful treatment with human menopausal gonadotropin.
18068163 Follitropin beta and, more precisely, follitropin alfa suppress the spectral components and power of the myoelectrical signals, which provides uterine quiescence.
17227474 There is a preliminary observation suggesting that the second most frequent FSHB haplotype may be associated with rapid conception success in females.
17079072 A major regulatory mechanism for FSH glycosylation involves control of beta-subunit N-glycosylation, possibly by inhibition of oligosaccharyl transferase. Two primate species exhibited the same all-or-none pattern of pituitary FSHbeta glycosylation.
17045735 The strategy to produce a soluble FSH-FSHR complex that involves the co-secretion of a truncated FSHR ectodomain (FSHR(HB)) and a covalently linked FSHalphabeta heterodimer, is described.
16100240 Sequence analysis shows that the human FSH beta gene is highly conserved and amino acid changing mutations are apparently extremely rare; only three silent polymorphisms, two of which are novel, are revealed.
15271874 LHX3 LIM homeodomain transcription factor is involved in activation of the FSH beta-subunit gene in the pituitary gonadotrope cell.
14585810 pituitary exit of LH and FSH occur via different secretion pathways, and are released spatially from the pituitary via different circulatory routes.
12963710 x-ray crystallographic analysis shows that the FSH beta subunit is close to the N-terminal region and the alpha subunit is projected toward exoloop 3 in the endodomain
12665510 Smad2 expression in ovarian cells requires a functional interplay between activin A (INHBA) and FSH/PKA signaling.
12568861 No mutation in this gene can still cause FSH deficiency in a person with normal virilization.
12568849 A Cys82Arg mutation in this protein causes FSH deficiency in FSH levels in vitro.
12374801 Follicle-stimulating hormone interacts with exoloop 3 of the receptor.
12161499 FSH beta gene mutations in a female with partial breast development and a male sibling with normal puberty and azoospermia
11900895 Review. The Asn7 and Asn24 glycosylation variants of human pituitary FSHB exhibit differential and divergent effects at the target cell level and that less sialylated, short-lived variants may exert significant effects in in vivo conditions.
11119757 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT      1 - 70
FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE                71 - 129
//

Text Mined References (80)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25052309 2015 The FSHB -211G>T variant attenuates serum FSH levels in the supraphysiological gonadotropin setting of Klinefelter syndrome.
24718625 2014 Reproductive physiology in young men is cumulatively affected by FSH-action modulating genetic variants: FSHR -29G/A and c.2039 A/G, FSHB -211G/T.
23850305 2013 FSHB-211 and FSHR 2039 are associated with serum levels of follicle-stimulating hormone and antimüllerian hormone in healthy girls: a longitudinal cohort study.
23766128 2013 A human FSHB promoter SNP associated with low FSH levels in men impairs LHX3 binding and basal FSHB transcription.
23504007 2013 The combination of genetic variants of the FSHB and FSHR genes affects serum FSH in women of reproductive age.
23426431 2013 Mechanisms of activin-stimulated FSH synthesis: the story of a pig and a FOX.
23423746 2013 Lack of specificity of plasma concentrations of inhibin B and follicle-stimulating hormone for identification of azoospermic survivors of childhood cancer: a report from the St Jude lifetime cohort study.
23380184 2013 Polymorphisms in gonadotropin and gonadotropin receptor genes as markers of ovarian reserve and response in in vitro fertilization.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23160221 2012 Effects of estradiol and progesterone on gonadotropin LH?- and FSH?-subunit promoter activities in gonadotroph L?T2 cells.
23118424 2013 Effects of the FSH-?-subunit promoter polymorphism -211G->T on the hypothalamic-pituitary-ovarian axis in normally cycling women indicate a gender-specific regulation of gonadotropin secretion.
23015653 2012 Negative fetal FSH/LH regulation in late pregnancy is associated with declined kisspeptin/KISS1R expression in the tuberal hypothalamus.
22791757 2012 Combined effects of the variants FSHB -211G>T and FSHR 2039A>G on male reproductive parameters.
22000911 2011 Toward a pharmacogenetic approach to male infertility: polymorphism of follicle-stimulating hormone beta-subunit promoter.
21733993 2011 Genetically determined dosage of follicle-stimulating hormone (FSH) affects male reproductive parameters.
21720063 2011 Feminizing adrenocortical carcinoma with selective suppression of follicle-stimulating hormone secretion and disorganized steroidogenesis: a case report and literature review.
21149714 2010 Follicle-stimulating hormone increases bone mass in female mice.
20869425 2010 An association study between the genetic polymorphisms within GnRHI, LH? and FSH? genes and central precocious puberty in Chinese girls.
20814826 2011 FSH isoform pattern in classic galactosemia.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20613903 2010 Follicular stimulating hormone enhances Notch 1 expression in SK-OV-3 ovarian cancer cells.
20488225 2010 Genomics and genetics of gonadotropin beta-subunit genes: Unique FSHB and duplicated LHB/CGB loci.
20233786 2010 FoxL2 Is required for activin induction of the mouse and human follicle-stimulating hormone beta-subunit genes.
19897680 2010 Increased Prevalance of the -211 T allele of follicle stimulating hormone (FSH) beta subunit promoter polymorphism and lower serum FSH in infertile men.
19734592 2009 [Relationship of serum FSH with bone mineral density, and prevalence of osteoporosis in Chinese women].
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19324968 2009 A novel role for the forkhead transcription factor FOXL2 in activin A-regulated follicle-stimulating hormone beta subunit transcription.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19054012 2009 Ghrelin suppresses secretion of FSH in males.
18653705 2008 Activator protein-1 and smad proteins synergistically regulate human follicle-stimulating hormone beta-promoter activity.
18567894 2008 FSHB promoter polymorphism within evolutionary conserved element is associated with serum FSH level in men.
18402948 2008 Isolated follicle-stimulating hormone (FSH) deficiency without mutation of the FSHbeta gene and successful treatment with human menopausal gonadotropin.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18068163 2008 Spectrotemporal changes in electrical activity of myometrium due to recombinant follicle-stimulating hormone preparations follitropin alfa and beta.
17227474 2007 Haplotype structure of FSHB, the beta-subunit gene for fertility-associated follicle-stimulating hormone: possible influence of balancing selection.
17079072 2007 All-or-none N-glycosylation in primate follicle-stimulating hormone beta-subunits.
17045735 2007 Assembly and structural characterization of an authentic complex between human follicle stimulating hormone and a hormone-binding ectodomain of its receptor.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16100240 2005 Human FSH beta subunit gene is highly conserved.
15662415 2005 Structure of human follicle-stimulating hormone in complex with its receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15271874 2004 Regulation of the follicle-stimulating hormone beta gene by the LHX3 LIM-homeodomain transcription factor.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14602737 2003 A pituitary-derived MEG3 isoform functions as a growth suppressor in tumor cells.
14585810 2004 Luteinizing hormone and follicle-stimulating hormone exhibit different secretion patterns from cultured Madin-Darby canine kidney cells.
14557487 2003 Expression of betaglycan, an inhibin coreceptor, in normal human ovaries and ovarian sex cord-stromal tumors and its regulation in cultured human granulosa-luteal cells.
12963710 2003 Orientation of follicle-stimulating hormone (FSH) subunits complexed with the FSH receptor. Beta subunit toward the N terminus of exodomain and alpha subunit to exoloop 3.
12665510 2003 Activin a signaling induces Smad2, but not Smad3, requiring protein kinase a activity in granulosa cells from the avian ovary.
12568861 2003 Isolated follicle-stimulating hormone (FSH) deficiency in a young man with normal virilization who did not have mutations in the FSHbeta gene.
12568849 2003 Analysis of the Cys82Arg mutation in follicle-stimulating hormone beta (FSHbeta) using a novel FSH expression vector.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374801 2002 Follicle-stimulating hormone interacts with exoloop 3 of the receptor.
12161499 2002 FSH beta gene mutations in a female with partial breast development and a male sibling with normal puberty and azoospermia.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11900895 2002 Assessment of the in vitro and in vivo biological activities of the human follicle-stimulating isohormones.
11514332 2001 Molecular biology of the channel catfish gonadotropin receptors: 2. Complementary DNA cloning, functional expression, and seasonal gene expression of the follicle-stimulating hormone receptor.
11502795 2001 Characterization of human FSH isoforms reveals a nonglycosylated beta-subunit in addition to the conventional glycosylated beta-subunit.
11501762 2001 Assignment of the complete disulphide bridge pattern in the human recombinant follitropin beta-chain.
11222739 2001 Three-dimensional structure of human follicle-stimulating hormone.
11119757 2000 Association of AccI polymorphism in the follicle-stimulating hormone beta gene with polycystic ovary syndrome.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10563789 1999 Synthesis of multi-subunit domain gonadotropin complexes: a model for alpha/beta heterodimer formation.
10395410 1999 Cysteine residues in a synthetic peptide corresponding to human follicle-stimulating hormone beta-subunit receptor-binding domain 81-95 [hFSH-beta-(81-95)] modulate the in vivo effects of hFSH-beta-(81-95) on the mouse estrous cycle.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9280841 1997 Isolated deficiency of follicle-stimulating hormone re-revisited.
9271483 1997 Delayed puberty and hypogonadism caused by mutations in the follicle-stimulating hormone beta-subunit gene.
8220432 1993 Primary amenorrhoea and infertility due to a mutation in the beta-subunit of follicle-stimulating hormone.
7850869 1994 Localization of follicle-stimulating hormone (FSH) immunoreactivity and hormone receptor mRNA in testicular tissue of infertile men.
6774759 1980 Studies on the disulfide bonds in human pituitary follicle-stimulating hormone.
4835136 1974 Human follicle stimulating hormone: first proposal for the amino acid sequence of the hormone-specific, beta subunit (hFSHb).
4368999 1974 Peptide hormones.
3151250 1988 A reevaluation of the amino acid sequence of human follitropin beta-subunit.
3139991 1988 Human follicle-stimulating hormone beta-subunit gene encodes multiple messenger ribonucleic acids.
2885163 1987 DNA sequence and regional assignment of the human follicle-stimulating hormone beta-subunit gene to the short arm of human chromosome 11.
2494176 1989 Expression of biologically active human follitropin in Chinese hamster ovary cells.
1249074 1976 Amino acid sequence of the beta subunit of follicle-stimulating hormone from human pituitary glands.