Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.50
PubTator Score 74.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.572 5.4e-04
adrenocortical carcinoma 1.221 4.3e-03
adult high grade glioma -2.000 1.3e-03
Astrocytoma, Pilocytic -2.200 1.3e-06
atypical teratoid / rhabdoid tumor -2.400 2.0e-04
chronic rhinosinusitis -1.014 3.0e-02
cystic fibrosis and chronic rhinosinusit... -1.969 3.2e-02
diabetes mellitus -1.300 2.0e-03
ependymoma 1.300 2.9e-02
gastric cancer 1.400 3.2e-04
glioblastoma -1.500 5.3e-04
group 3 medulloblastoma 1.600 1.2e-04
intraductal papillary-mucinous adenoma (... -1.400 2.7e-03
juvenile dermatomyositis 1.195 6.7e-07
medulloblastoma, large-cell -1.900 6.5e-03
non primary Sjogren syndrome sicca -1.100 1.7e-02
ovarian cancer -1.200 1.7e-04
pituitary cancer 1.100 9.7e-04
sarcoidosis 1.500 3.5e-02

Synonym

Accession Q9BXM9 A2A338 A6NKH7 B7Z5S6 B7Z5W3 Q5T879 Q5T880
Symbols MIR1
CCDC10
FSD1CL
FSD1NL
CSDUFD1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MDSQKYCFKENENVTVDKACFLISNITIGPESINLQQEALQRIISTLANKNDEIQNFIDTLHHTLKGVQE      1 - 70
NSSNILSELDEEFDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCNNALENSEELLEFATRSLDIK     71 - 140
EPEEFSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVA    141 - 210
DNSVTVAWRMPEEDNKIDHFILEHRKTNFDGLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRA    211 - 280
CNKAVAGEYSDPVTLETKALNFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKR    281 - 350
TSVGSRPPAVRGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSW    351 - 420
CIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMV    421 - 490
WCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ                                  491 - 530
//

Text Mined References (10)

PMID Year Title